Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9HWT2

Protein Details
Accession W9HWT2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
88-110RQPSTKGKGKEKQKQKQKPEEGVBasic
NLS Segment(s)
PositionSequence
93-103KGKGKEKQKQK
Subcellular Location(s) nucl 13, cyto 5, pero 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009288  AIG2-like_dom  
IPR017939  G-Glutamylcylcotransferase  
IPR013024  GGCT-like  
IPR036568  GGCT-like_sf  
Gene Ontology GO:0003839  F:gamma-glutamylcyclotransferase activity  
Pfam View protein in Pfam  
PF06094  GGACT  
CDD cd06661  GGCT_like  
Amino Acid Sequences MSSQGDSQPSQDSTMTLMQENLSEVLYFAYGSNLSTKQMRRRCPYSTPVGLAYLKGWRWIINERGYANVVQLPIDSDNDETPEAEDNRQPSTKGKGKEKQKQKQKPEEGVYGLLYLVPADDEESLDRYEGVPSAYQKFQVDVKWASANEEEDETLRALVYVDEMRVEEDVPREEYIERMEDGIEDAVENWGMDEDYADRVMRRFWIEKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.19
4 0.18
5 0.16
6 0.16
7 0.17
8 0.14
9 0.11
10 0.09
11 0.09
12 0.08
13 0.08
14 0.08
15 0.06
16 0.07
17 0.07
18 0.08
19 0.11
20 0.11
21 0.13
22 0.19
23 0.24
24 0.32
25 0.4
26 0.48
27 0.53
28 0.58
29 0.61
30 0.62
31 0.63
32 0.62
33 0.59
34 0.53
35 0.47
36 0.45
37 0.39
38 0.33
39 0.28
40 0.23
41 0.19
42 0.19
43 0.18
44 0.15
45 0.18
46 0.23
47 0.27
48 0.27
49 0.31
50 0.28
51 0.3
52 0.3
53 0.27
54 0.23
55 0.19
56 0.14
57 0.11
58 0.1
59 0.1
60 0.09
61 0.1
62 0.1
63 0.09
64 0.09
65 0.1
66 0.1
67 0.09
68 0.09
69 0.12
70 0.12
71 0.13
72 0.14
73 0.14
74 0.17
75 0.17
76 0.18
77 0.16
78 0.23
79 0.28
80 0.32
81 0.39
82 0.44
83 0.53
84 0.61
85 0.7
86 0.71
87 0.76
88 0.8
89 0.81
90 0.84
91 0.82
92 0.8
93 0.73
94 0.67
95 0.58
96 0.49
97 0.39
98 0.29
99 0.21
100 0.14
101 0.09
102 0.06
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.04
109 0.05
110 0.06
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.08
118 0.08
119 0.1
120 0.13
121 0.14
122 0.15
123 0.15
124 0.16
125 0.18
126 0.17
127 0.2
128 0.18
129 0.2
130 0.21
131 0.21
132 0.22
133 0.21
134 0.21
135 0.17
136 0.17
137 0.15
138 0.12
139 0.13
140 0.11
141 0.1
142 0.08
143 0.07
144 0.06
145 0.06
146 0.08
147 0.07
148 0.07
149 0.08
150 0.08
151 0.09
152 0.09
153 0.09
154 0.09
155 0.1
156 0.13
157 0.15
158 0.15
159 0.15
160 0.15
161 0.16
162 0.17
163 0.17
164 0.15
165 0.13
166 0.13
167 0.12
168 0.13
169 0.12
170 0.1
171 0.07
172 0.07
173 0.08
174 0.08
175 0.07
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.07
182 0.09
183 0.11
184 0.11
185 0.12
186 0.13
187 0.14
188 0.18
189 0.22