Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9J8X1

Protein Details
Accession W9J8X1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
41-63TSRVSTDRMRRDNRKKKAKVSVTHydrophilic
NLS Segment(s)
PositionSequence
52-58DNRKKKA
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MGSGARPPRPRTLRPSQSLSQHAHTVREIRAHGTESIADTTSRVSTDRMRRDNRKKKAKVSVTLLYDPGWLRSQTTPGLLARYKNREEDIFKLISLSIWMTTEMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.67
4 0.67
5 0.67
6 0.63
7 0.55
8 0.51
9 0.46
10 0.41
11 0.38
12 0.34
13 0.3
14 0.3
15 0.27
16 0.23
17 0.23
18 0.23
19 0.22
20 0.19
21 0.17
22 0.15
23 0.15
24 0.13
25 0.11
26 0.09
27 0.1
28 0.09
29 0.09
30 0.08
31 0.09
32 0.15
33 0.23
34 0.32
35 0.38
36 0.45
37 0.55
38 0.66
39 0.74
40 0.78
41 0.8
42 0.78
43 0.78
44 0.81
45 0.78
46 0.73
47 0.7
48 0.66
49 0.59
50 0.54
51 0.47
52 0.37
53 0.32
54 0.26
55 0.21
56 0.17
57 0.13
58 0.14
59 0.14
60 0.17
61 0.16
62 0.17
63 0.17
64 0.16
65 0.21
66 0.2
67 0.24
68 0.29
69 0.35
70 0.37
71 0.37
72 0.4
73 0.4
74 0.42
75 0.42
76 0.4
77 0.34
78 0.31
79 0.28
80 0.25
81 0.2
82 0.18
83 0.14
84 0.1
85 0.1