Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9J5F1

Protein Details
Accession W9J5F1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
363-387KSPAPGKKPKPESMRIKKPAKKELEBasic
NLS Segment(s)
PositionSequence
361-384RGKSPAPGKKPKPESMRIKKPAKK
Subcellular Location(s) mito 14.5, mito_nucl 10.666, cyto_nucl 7.333, cyto 7, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001837  Adenylate_cyclase-assoc_CAP  
IPR013912  Adenylate_cyclase-assoc_CAP_C  
IPR013992  Adenylate_cyclase-assoc_CAP_N  
IPR017901  C-CAP_CF_C-like  
IPR016098  CAP/MinC_C  
IPR036223  CAP_C_sf  
IPR018106  CAP_CS_N  
IPR036222  CAP_N_sf  
IPR006599  CARP_motif  
Gene Ontology GO:0003779  F:actin binding  
GO:0007010  P:cytoskeleton organization  
Pfam View protein in Pfam  
PF08603  CAP_C  
PF01213  CAP_N  
PROSITE View protein in PROSITE  
PS51329  C_CAP_COFACTOR_C  
PS01088  CAP_1  
Amino Acid Sequences MAANSQMHNLTTLIKRLEAATSRLEDIASSTEPPADAAILNQVIPSPPNPSLAAPPPPAASDSKATTPAAAKPEPVAEPLPESIEEFDAFLNTSVDKYVKLSHQLGGLVAEQAALVKSGFQEQRKFLLISTKAKKPNLSGPDLPVYESLIKPINEALMAVTELKDANRPSPMYTQLSTVSDGIMVLAWVTIDTRPYKHVDECLGSAQFFGNRVLKEQKDKDPKQIEWVQSFYQMFRDLADYVKQYFPTGIPWNPNGQPAQEVLKSLSAGSAPASAPTAPAPAAGGAPPPPPPPPPPGPPPVLDIKTDDAPAPASSGGFGAVFSELNKGDAVTKGLRKVDKSEMTHKNPSLRSGSTVSSGQRGKSPAPGKKPKPESMRIKKPAKKELEGNKWTIENYEKEAEPIEIEASLTHSVLISRCNNTTIIVRGKANQVTVENSTRLSLIVDTLVSTVDVVKANNFALQVMGTIPTVMLDQVDSAQIYFSKESIGTKVFTSKSAGVNLNVISGEDDDYKELPLPSQICSYYDESKGDLVNEIVAHAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.25
4 0.3
5 0.28
6 0.28
7 0.28
8 0.29
9 0.3
10 0.3
11 0.28
12 0.22
13 0.2
14 0.21
15 0.17
16 0.16
17 0.15
18 0.16
19 0.16
20 0.16
21 0.15
22 0.11
23 0.1
24 0.09
25 0.13
26 0.13
27 0.13
28 0.12
29 0.12
30 0.12
31 0.14
32 0.14
33 0.15
34 0.15
35 0.18
36 0.2
37 0.21
38 0.26
39 0.3
40 0.36
41 0.33
42 0.33
43 0.31
44 0.31
45 0.31
46 0.28
47 0.26
48 0.24
49 0.25
50 0.26
51 0.28
52 0.27
53 0.27
54 0.27
55 0.29
56 0.3
57 0.28
58 0.26
59 0.25
60 0.28
61 0.27
62 0.27
63 0.24
64 0.18
65 0.2
66 0.2
67 0.21
68 0.17
69 0.17
70 0.16
71 0.16
72 0.15
73 0.12
74 0.12
75 0.1
76 0.1
77 0.1
78 0.09
79 0.08
80 0.08
81 0.09
82 0.09
83 0.09
84 0.11
85 0.15
86 0.17
87 0.24
88 0.25
89 0.26
90 0.27
91 0.27
92 0.26
93 0.23
94 0.2
95 0.14
96 0.12
97 0.1
98 0.07
99 0.07
100 0.07
101 0.06
102 0.05
103 0.05
104 0.06
105 0.13
106 0.18
107 0.22
108 0.27
109 0.29
110 0.33
111 0.36
112 0.36
113 0.29
114 0.34
115 0.35
116 0.39
117 0.43
118 0.47
119 0.5
120 0.53
121 0.54
122 0.49
123 0.53
124 0.5
125 0.51
126 0.45
127 0.43
128 0.46
129 0.43
130 0.4
131 0.31
132 0.28
133 0.24
134 0.21
135 0.19
136 0.18
137 0.17
138 0.17
139 0.17
140 0.15
141 0.12
142 0.13
143 0.11
144 0.07
145 0.07
146 0.07
147 0.07
148 0.07
149 0.07
150 0.07
151 0.11
152 0.11
153 0.12
154 0.16
155 0.17
156 0.19
157 0.22
158 0.27
159 0.27
160 0.27
161 0.27
162 0.25
163 0.26
164 0.25
165 0.21
166 0.16
167 0.12
168 0.11
169 0.09
170 0.06
171 0.05
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.04
178 0.06
179 0.08
180 0.09
181 0.11
182 0.15
183 0.18
184 0.19
185 0.21
186 0.22
187 0.23
188 0.23
189 0.24
190 0.21
191 0.18
192 0.17
193 0.15
194 0.12
195 0.12
196 0.13
197 0.13
198 0.13
199 0.16
200 0.21
201 0.23
202 0.3
203 0.34
204 0.41
205 0.48
206 0.5
207 0.56
208 0.57
209 0.55
210 0.55
211 0.57
212 0.51
213 0.43
214 0.44
215 0.35
216 0.33
217 0.33
218 0.25
219 0.2
220 0.18
221 0.15
222 0.13
223 0.14
224 0.1
225 0.11
226 0.13
227 0.12
228 0.13
229 0.14
230 0.14
231 0.12
232 0.13
233 0.12
234 0.14
235 0.17
236 0.17
237 0.18
238 0.19
239 0.23
240 0.23
241 0.25
242 0.21
243 0.18
244 0.17
245 0.15
246 0.17
247 0.14
248 0.13
249 0.12
250 0.12
251 0.12
252 0.11
253 0.1
254 0.07
255 0.06
256 0.06
257 0.07
258 0.06
259 0.06
260 0.07
261 0.06
262 0.07
263 0.07
264 0.07
265 0.05
266 0.05
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.06
273 0.07
274 0.08
275 0.09
276 0.11
277 0.13
278 0.15
279 0.2
280 0.24
281 0.28
282 0.32
283 0.35
284 0.36
285 0.35
286 0.35
287 0.35
288 0.32
289 0.28
290 0.25
291 0.23
292 0.21
293 0.21
294 0.18
295 0.12
296 0.12
297 0.11
298 0.1
299 0.08
300 0.07
301 0.06
302 0.06
303 0.06
304 0.05
305 0.05
306 0.04
307 0.05
308 0.05
309 0.05
310 0.07
311 0.07
312 0.07
313 0.08
314 0.07
315 0.08
316 0.09
317 0.11
318 0.13
319 0.15
320 0.18
321 0.22
322 0.23
323 0.24
324 0.27
325 0.33
326 0.36
327 0.39
328 0.45
329 0.5
330 0.55
331 0.6
332 0.58
333 0.57
334 0.51
335 0.5
336 0.45
337 0.36
338 0.33
339 0.29
340 0.28
341 0.24
342 0.25
343 0.22
344 0.24
345 0.25
346 0.22
347 0.23
348 0.24
349 0.23
350 0.29
351 0.36
352 0.36
353 0.45
354 0.55
355 0.58
356 0.65
357 0.71
358 0.71
359 0.72
360 0.75
361 0.76
362 0.76
363 0.81
364 0.81
365 0.83
366 0.81
367 0.81
368 0.81
369 0.76
370 0.7
371 0.68
372 0.69
373 0.69
374 0.67
375 0.62
376 0.54
377 0.48
378 0.44
379 0.37
380 0.31
381 0.22
382 0.23
383 0.24
384 0.22
385 0.21
386 0.22
387 0.2
388 0.17
389 0.15
390 0.11
391 0.07
392 0.07
393 0.07
394 0.09
395 0.09
396 0.08
397 0.08
398 0.07
399 0.09
400 0.09
401 0.14
402 0.16
403 0.18
404 0.19
405 0.2
406 0.21
407 0.21
408 0.23
409 0.24
410 0.26
411 0.26
412 0.26
413 0.28
414 0.33
415 0.33
416 0.32
417 0.28
418 0.25
419 0.25
420 0.28
421 0.29
422 0.24
423 0.23
424 0.22
425 0.2
426 0.18
427 0.16
428 0.11
429 0.09
430 0.09
431 0.08
432 0.08
433 0.08
434 0.08
435 0.07
436 0.07
437 0.06
438 0.08
439 0.09
440 0.09
441 0.1
442 0.12
443 0.12
444 0.14
445 0.13
446 0.11
447 0.1
448 0.1
449 0.09
450 0.08
451 0.09
452 0.07
453 0.07
454 0.07
455 0.07
456 0.07
457 0.06
458 0.06
459 0.05
460 0.05
461 0.06
462 0.08
463 0.07
464 0.07
465 0.08
466 0.09
467 0.12
468 0.12
469 0.11
470 0.12
471 0.13
472 0.15
473 0.18
474 0.2
475 0.18
476 0.19
477 0.26
478 0.25
479 0.25
480 0.29
481 0.29
482 0.3
483 0.35
484 0.36
485 0.3
486 0.32
487 0.31
488 0.27
489 0.23
490 0.2
491 0.15
492 0.13
493 0.14
494 0.13
495 0.13
496 0.14
497 0.15
498 0.16
499 0.17
500 0.17
501 0.15
502 0.2
503 0.2
504 0.21
505 0.25
506 0.25
507 0.23
508 0.28
509 0.32
510 0.31
511 0.33
512 0.32
513 0.29
514 0.3
515 0.3
516 0.27
517 0.23
518 0.19
519 0.17
520 0.16