Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9IHW1

Protein Details
Accession W9IHW1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
33-54AVVDKAKKQYKQRTQNKSEDDRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 27
Family & Domain DBs
Amino Acid Sequences MHFPGVTKRRNSFQHYVNINCCKNSTYKQHVVAVVDKAKKQYKQRTQNKSEDDRSEGDESEGDESESDESEGDGTSSSTGMDIDLPEPTDEDLTTQISVLHIASKNSNGETHRVTKTAKKRHFDDKGDTDGAAASGSKRTRVAHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.63
3 0.65
4 0.65
5 0.66
6 0.59
7 0.53
8 0.48
9 0.4
10 0.39
11 0.4
12 0.41
13 0.41
14 0.46
15 0.5
16 0.53
17 0.53
18 0.51
19 0.48
20 0.44
21 0.41
22 0.38
23 0.35
24 0.36
25 0.39
26 0.42
27 0.48
28 0.54
29 0.58
30 0.65
31 0.74
32 0.79
33 0.81
34 0.84
35 0.83
36 0.8
37 0.75
38 0.67
39 0.6
40 0.51
41 0.47
42 0.4
43 0.32
44 0.24
45 0.19
46 0.17
47 0.14
48 0.13
49 0.09
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.03
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.1
88 0.1
89 0.11
90 0.12
91 0.15
92 0.16
93 0.17
94 0.2
95 0.17
96 0.2
97 0.23
98 0.28
99 0.28
100 0.29
101 0.3
102 0.36
103 0.45
104 0.52
105 0.56
106 0.57
107 0.6
108 0.68
109 0.75
110 0.73
111 0.72
112 0.67
113 0.65
114 0.6
115 0.55
116 0.44
117 0.35
118 0.29
119 0.2
120 0.14
121 0.08
122 0.13
123 0.15
124 0.17
125 0.2