Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GZR3

Protein Details
Accession C1GZR3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
44-63DGYWQSRRRKPRLQQFETTWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 5.5, mito 5, cyto_pero 3.5
Family & Domain DBs
KEGG pbl:PAAG_04007  -  
Amino Acid Sequences MASRAASKISGINELFNDSENTGNLDHVLLWADRQQPVVMLVLDGYWQSRRRKPRLQQFETTWHKGPIGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.19
4 0.18
5 0.13
6 0.14
7 0.12
8 0.13
9 0.11
10 0.11
11 0.1
12 0.08
13 0.07
14 0.07
15 0.08
16 0.06
17 0.06
18 0.09
19 0.1
20 0.11
21 0.11
22 0.11
23 0.1
24 0.11
25 0.11
26 0.08
27 0.06
28 0.06
29 0.05
30 0.06
31 0.05
32 0.06
33 0.09
34 0.15
35 0.21
36 0.28
37 0.38
38 0.46
39 0.56
40 0.65
41 0.73
42 0.78
43 0.8
44 0.81
45 0.78
46 0.8
47 0.78
48 0.74
49 0.66
50 0.56