Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9I0Z8

Protein Details
Accession W9I0Z8   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
159-180GSLKTKASRKHGKEYSKARARFHydrophilic
NLS Segment(s)
PositionSequence
162-178KTKASRKHGKEYSKARA
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR019371  KxDL_dom  
Gene Ontology GO:0005768  C:endosome  
Pfam View protein in Pfam  
PF10241  KxDL  
Amino Acid Sequences MSSHYTPVGYSMPLPVPSKGSQYPTYSQYSVSPPECDHSVSSASGIPSYSNGGYSATSSGYQYSGGYGEYESTRSASGVDFQEYMQDRFANSFDPIPLDRSMAMQAQTSGKMNAKHRELMELQKKAQARLAKTRERFQEGMRDAHEVRSDLEWTQKKVGSLKTKASRKHGKEYSKARARFPSPEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.25
4 0.26
5 0.31
6 0.31
7 0.34
8 0.34
9 0.37
10 0.4
11 0.4
12 0.44
13 0.38
14 0.36
15 0.33
16 0.33
17 0.34
18 0.32
19 0.3
20 0.25
21 0.28
22 0.28
23 0.26
24 0.23
25 0.19
26 0.19
27 0.17
28 0.17
29 0.16
30 0.15
31 0.14
32 0.13
33 0.11
34 0.1
35 0.12
36 0.11
37 0.09
38 0.09
39 0.1
40 0.1
41 0.1
42 0.1
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.09
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.06
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.08
63 0.07
64 0.1
65 0.1
66 0.11
67 0.11
68 0.1
69 0.15
70 0.16
71 0.17
72 0.14
73 0.13
74 0.12
75 0.13
76 0.13
77 0.1
78 0.09
79 0.09
80 0.08
81 0.1
82 0.1
83 0.11
84 0.12
85 0.11
86 0.1
87 0.11
88 0.12
89 0.11
90 0.11
91 0.09
92 0.1
93 0.1
94 0.11
95 0.11
96 0.12
97 0.13
98 0.17
99 0.22
100 0.27
101 0.29
102 0.32
103 0.31
104 0.34
105 0.34
106 0.38
107 0.42
108 0.39
109 0.38
110 0.38
111 0.39
112 0.35
113 0.38
114 0.33
115 0.29
116 0.36
117 0.43
118 0.47
119 0.5
120 0.57
121 0.58
122 0.6
123 0.57
124 0.49
125 0.51
126 0.45
127 0.45
128 0.39
129 0.38
130 0.32
131 0.33
132 0.33
133 0.24
134 0.22
135 0.2
136 0.21
137 0.17
138 0.25
139 0.27
140 0.28
141 0.32
142 0.33
143 0.33
144 0.37
145 0.45
146 0.45
147 0.46
148 0.53
149 0.57
150 0.63
151 0.67
152 0.72
153 0.75
154 0.71
155 0.77
156 0.76
157 0.75
158 0.78
159 0.81
160 0.82
161 0.81
162 0.78
163 0.74
164 0.74
165 0.7