Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9HAB9

Protein Details
Accession W9HAB9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-28FSSGRPQPPMPRQPKPSRSPESVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MDNIIFSSGRPQPPMPRQPKPSRSPESVSLIKTFLRALPKGEEDWDDKAPRTQEQIEQLRLDLTLSKLVREGRAKMKPKALLQSFAEEHAALLRNLESQIHSFVFIALGDVAIKSDLPVRDVDEMTMAYTGAQRSAVRTLRLGVRRWIKASDTLRQSWLPRADELPLRRRSFIHIMKKIPDEDIGILREMTIEGDRAVLADVKVYIPKKQLPSSSLRIPNIIYELHGGKLSLVDIERHLAVPTASNATVGDDDDDSTNHNMMQVMEGFVVATREPVRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.65
4 0.72
5 0.79
6 0.85
7 0.84
8 0.84
9 0.81
10 0.78
11 0.75
12 0.71
13 0.68
14 0.64
15 0.58
16 0.49
17 0.43
18 0.37
19 0.32
20 0.27
21 0.23
22 0.24
23 0.23
24 0.24
25 0.28
26 0.3
27 0.3
28 0.31
29 0.31
30 0.28
31 0.31
32 0.33
33 0.3
34 0.28
35 0.31
36 0.31
37 0.3
38 0.32
39 0.31
40 0.3
41 0.37
42 0.43
43 0.42
44 0.4
45 0.38
46 0.33
47 0.3
48 0.26
49 0.18
50 0.13
51 0.16
52 0.16
53 0.16
54 0.18
55 0.2
56 0.25
57 0.27
58 0.3
59 0.32
60 0.42
61 0.48
62 0.5
63 0.55
64 0.55
65 0.55
66 0.59
67 0.53
68 0.49
69 0.44
70 0.45
71 0.39
72 0.34
73 0.31
74 0.21
75 0.19
76 0.16
77 0.16
78 0.1
79 0.1
80 0.09
81 0.09
82 0.1
83 0.1
84 0.09
85 0.08
86 0.11
87 0.11
88 0.11
89 0.1
90 0.1
91 0.1
92 0.08
93 0.08
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.07
103 0.07
104 0.08
105 0.09
106 0.11
107 0.13
108 0.13
109 0.13
110 0.1
111 0.1
112 0.09
113 0.09
114 0.07
115 0.05
116 0.06
117 0.06
118 0.05
119 0.07
120 0.06
121 0.07
122 0.13
123 0.14
124 0.14
125 0.14
126 0.16
127 0.21
128 0.25
129 0.25
130 0.26
131 0.31
132 0.32
133 0.33
134 0.32
135 0.27
136 0.31
137 0.33
138 0.33
139 0.31
140 0.31
141 0.32
142 0.32
143 0.32
144 0.31
145 0.32
146 0.27
147 0.23
148 0.23
149 0.23
150 0.26
151 0.3
152 0.33
153 0.36
154 0.36
155 0.36
156 0.36
157 0.39
158 0.43
159 0.47
160 0.49
161 0.48
162 0.49
163 0.52
164 0.54
165 0.49
166 0.41
167 0.33
168 0.25
169 0.2
170 0.19
171 0.17
172 0.14
173 0.13
174 0.12
175 0.11
176 0.1
177 0.09
178 0.07
179 0.06
180 0.05
181 0.06
182 0.06
183 0.06
184 0.06
185 0.07
186 0.06
187 0.06
188 0.07
189 0.07
190 0.12
191 0.13
192 0.15
193 0.18
194 0.24
195 0.29
196 0.33
197 0.36
198 0.36
199 0.42
200 0.45
201 0.5
202 0.52
203 0.47
204 0.44
205 0.41
206 0.38
207 0.34
208 0.27
209 0.19
210 0.15
211 0.15
212 0.15
213 0.15
214 0.13
215 0.11
216 0.11
217 0.11
218 0.09
219 0.09
220 0.09
221 0.1
222 0.12
223 0.13
224 0.13
225 0.13
226 0.12
227 0.11
228 0.12
229 0.13
230 0.15
231 0.14
232 0.14
233 0.14
234 0.15
235 0.16
236 0.14
237 0.14
238 0.1
239 0.11
240 0.12
241 0.12
242 0.13
243 0.14
244 0.14
245 0.13
246 0.13
247 0.13
248 0.13
249 0.16
250 0.14
251 0.13
252 0.13
253 0.13
254 0.11
255 0.11
256 0.12
257 0.09
258 0.11