Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9J4Q7

Protein Details
Accession W9J4Q7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-66LESCNRRYQRHKGPDPRHRESFBasic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 8, E.R. 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDRRNMNSGVRFCQWRVELQSFFWIIDSIPLSYMRRHHLPSFIVLESCNRRYQRHKGPDPRHRESFAAIHVEGVSGYAVVPAGLPKSGDSGRRGTRVLPASLSVLFIVLLFLIICGFDSSELRVPKVFYSRRPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.42
4 0.42
5 0.38
6 0.36
7 0.41
8 0.34
9 0.32
10 0.27
11 0.2
12 0.14
13 0.15
14 0.15
15 0.1
16 0.1
17 0.13
18 0.14
19 0.16
20 0.2
21 0.22
22 0.25
23 0.28
24 0.29
25 0.31
26 0.31
27 0.32
28 0.33
29 0.28
30 0.24
31 0.21
32 0.24
33 0.24
34 0.25
35 0.28
36 0.26
37 0.29
38 0.35
39 0.44
40 0.5
41 0.55
42 0.63
43 0.68
44 0.76
45 0.81
46 0.84
47 0.81
48 0.74
49 0.65
50 0.56
51 0.48
52 0.39
53 0.32
54 0.26
55 0.19
56 0.16
57 0.14
58 0.13
59 0.1
60 0.08
61 0.06
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.04
70 0.04
71 0.04
72 0.05
73 0.08
74 0.1
75 0.14
76 0.16
77 0.22
78 0.25
79 0.28
80 0.29
81 0.26
82 0.32
83 0.32
84 0.31
85 0.25
86 0.23
87 0.22
88 0.22
89 0.21
90 0.14
91 0.1
92 0.09
93 0.08
94 0.07
95 0.04
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.04
103 0.05
104 0.06
105 0.07
106 0.1
107 0.17
108 0.19
109 0.2
110 0.21
111 0.22
112 0.26
113 0.35
114 0.36