Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9IJ65

Protein Details
Accession W9IJ65    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
25-49FAYKLYQSKKWPRVRKAFRWMNPFSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 5, E.R. 5, golg 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTEVIVTIVYSTLGLVVSCVGLFFAYKLYQSKKWPRVRKAFRWMNPFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.03
9 0.03
10 0.03
11 0.03
12 0.05
13 0.05
14 0.06
15 0.09
16 0.14
17 0.18
18 0.27
19 0.38
20 0.46
21 0.56
22 0.65
23 0.72
24 0.79
25 0.85
26 0.86
27 0.87
28 0.88
29 0.86