Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9IQI8

Protein Details
Accession W9IQI8   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
103-122SPKVTPCKRRAPKTPESDSKHydrophilic
NLS Segment(s)
PositionSequence
78-92KKATSARKRGPKAKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSDAAVKPNAWTDEAKNELLLRIIAQLKPEGKSINWSEINMEGRTVKSLQNQWTFFNKKLEAFKTQSNDGSTPSTPAKKATSARKRGPKAKKVAPDDDEVYESPKVTPCKRRAPKTPESDSKAVKKELSEAVVKDEEMEDDRDVDGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.28
4 0.27
5 0.25
6 0.23
7 0.21
8 0.13
9 0.14
10 0.16
11 0.16
12 0.17
13 0.21
14 0.22
15 0.23
16 0.25
17 0.22
18 0.19
19 0.26
20 0.27
21 0.3
22 0.29
23 0.28
24 0.27
25 0.3
26 0.33
27 0.26
28 0.24
29 0.17
30 0.16
31 0.18
32 0.18
33 0.16
34 0.18
35 0.23
36 0.3
37 0.35
38 0.36
39 0.37
40 0.44
41 0.46
42 0.43
43 0.42
44 0.37
45 0.33
46 0.37
47 0.37
48 0.34
49 0.34
50 0.35
51 0.33
52 0.34
53 0.32
54 0.29
55 0.27
56 0.23
57 0.23
58 0.18
59 0.18
60 0.18
61 0.18
62 0.16
63 0.18
64 0.17
65 0.19
66 0.24
67 0.33
68 0.4
69 0.47
70 0.55
71 0.62
72 0.67
73 0.72
74 0.77
75 0.75
76 0.73
77 0.72
78 0.73
79 0.7
80 0.7
81 0.63
82 0.58
83 0.51
84 0.44
85 0.39
86 0.3
87 0.27
88 0.2
89 0.18
90 0.15
91 0.17
92 0.21
93 0.25
94 0.34
95 0.38
96 0.49
97 0.58
98 0.65
99 0.71
100 0.75
101 0.79
102 0.79
103 0.81
104 0.79
105 0.78
106 0.75
107 0.71
108 0.7
109 0.65
110 0.59
111 0.51
112 0.43
113 0.4
114 0.39
115 0.36
116 0.32
117 0.28
118 0.3
119 0.3
120 0.29
121 0.25
122 0.21
123 0.19
124 0.18
125 0.2
126 0.15
127 0.15
128 0.15