Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6CVS8

Protein Details
Accession Q6CVS8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-33RLANEKWAKKNEKKLGKPKVKAKDQBasic
NLS Segment(s)
PositionSequence
14-31KWAKKNEKKLGKPKVKAK
Subcellular Location(s) plas 9, mito 6, nucl 4.5, cyto_nucl 3.5, E.R. 3, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
KEGG kla:KLLA0_B09724g  -  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAIQTPRQRLANEKWAKKNEKKLGKPKVKAKDQVSKSPISKPWIIALIFLLIGGAILELVSLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.75
4 0.76
5 0.79
6 0.77
7 0.78
8 0.8
9 0.81
10 0.83
11 0.84
12 0.84
13 0.82
14 0.82
15 0.79
16 0.77
17 0.73
18 0.71
19 0.66
20 0.66
21 0.61
22 0.56
23 0.5
24 0.48
25 0.46
26 0.41
27 0.38
28 0.31
29 0.3
30 0.3
31 0.28
32 0.23
33 0.19
34 0.16
35 0.14
36 0.12
37 0.1
38 0.05
39 0.05
40 0.04
41 0.03
42 0.02
43 0.02
44 0.02