Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CVC8

Protein Details
Accession Q6CVC8   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MLKRHRSGKKEKKPKKKKKRKVANDNPNSIHLBasic
NLS Segment(s)
PositionSequence
3-21KRHRSGKKEKKPKKKKKRK
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR019835  SWIB_domain  
IPR036885  SWIB_MDM2_dom_sf  
IPR003121  SWIB_MDM2_domain  
KEGG kla:KLLA0_B13024g  -  
Pfam View protein in Pfam  
PF02201  SWIB  
PROSITE View protein in PROSITE  
PS51925  SWIB_MDM2  
CDD cd10567  SWIB-MDM2_like  
Amino Acid Sequences MLKRHRSGKKEKKPKKKKKRKVANDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDDAMKPIFGEKMTMFTLNKILSKHLFNLAKSEKDEITEQHSDLEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.96
3 0.96
4 0.96
5 0.96
6 0.97
7 0.97
8 0.97
9 0.97
10 0.96
11 0.94
12 0.91
13 0.82
14 0.76
15 0.7
16 0.58
17 0.49
18 0.39
19 0.31
20 0.24
21 0.26
22 0.24
23 0.2
24 0.21
25 0.2
26 0.22
27 0.23
28 0.21
29 0.17
30 0.14
31 0.14
32 0.16
33 0.14
34 0.11
35 0.13
36 0.14
37 0.16
38 0.18
39 0.18
40 0.15
41 0.19
42 0.19
43 0.18
44 0.19
45 0.24
46 0.22
47 0.23
48 0.24
49 0.22
50 0.25
51 0.23
52 0.22
53 0.19
54 0.21
55 0.2
56 0.27
57 0.29
58 0.26
59 0.26
60 0.27
61 0.24
62 0.25
63 0.24
64 0.18
65 0.16
66 0.16
67 0.16
68 0.2
69 0.19
70 0.16
71 0.15
72 0.14
73 0.14
74 0.12
75 0.14
76 0.09
77 0.12
78 0.13
79 0.16
80 0.15
81 0.15
82 0.19
83 0.19
84 0.21
85 0.19
86 0.21
87 0.22
88 0.24
89 0.26
90 0.3
91 0.33
92 0.31
93 0.39
94 0.4
95 0.41
96 0.4
97 0.42
98 0.33
99 0.32
100 0.34
101 0.28
102 0.3
103 0.29
104 0.27