Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9IYN2

Protein Details
Accession W9IYN2   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-56GKPREKLTNAQKEKRKNHKVPYRKDGLBasic
NLS Segment(s)
PositionSequence
39-51AQKEKRKNHKVPY
Subcellular Location(s) nucl 13.5mito_nucl 13.5, mito 12.5
Family & Domain DBs
Amino Acid Sequences MCQKSSYERRCEDCHMRVIISVVTHQVCGGKPREKLTNAQKEKRKNHKVPYRKDGLICKLRVRPHKKYWSYIAAHTCMRCSLQKLRKEAEEELKALVDGNGMESEINLKKERLKRLKEEMMDTGLPPKDYKKALPKAIEVNMKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.54
3 0.48
4 0.43
5 0.39
6 0.32
7 0.24
8 0.2
9 0.17
10 0.15
11 0.15
12 0.14
13 0.15
14 0.14
15 0.19
16 0.23
17 0.25
18 0.28
19 0.32
20 0.39
21 0.38
22 0.46
23 0.51
24 0.57
25 0.59
26 0.65
27 0.68
28 0.71
29 0.79
30 0.82
31 0.82
32 0.79
33 0.81
34 0.83
35 0.86
36 0.85
37 0.83
38 0.79
39 0.71
40 0.67
41 0.62
42 0.6
43 0.57
44 0.5
45 0.47
46 0.45
47 0.48
48 0.55
49 0.57
50 0.57
51 0.59
52 0.67
53 0.66
54 0.65
55 0.64
56 0.61
57 0.55
58 0.51
59 0.44
60 0.36
61 0.35
62 0.31
63 0.26
64 0.19
65 0.18
66 0.15
67 0.16
68 0.23
69 0.29
70 0.34
71 0.38
72 0.4
73 0.42
74 0.45
75 0.45
76 0.43
77 0.38
78 0.34
79 0.3
80 0.27
81 0.24
82 0.2
83 0.16
84 0.08
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.05
91 0.09
92 0.11
93 0.14
94 0.14
95 0.15
96 0.23
97 0.3
98 0.41
99 0.46
100 0.51
101 0.57
102 0.65
103 0.72
104 0.69
105 0.66
106 0.59
107 0.54
108 0.48
109 0.41
110 0.37
111 0.3
112 0.28
113 0.24
114 0.24
115 0.25
116 0.27
117 0.34
118 0.39
119 0.46
120 0.53
121 0.57
122 0.59
123 0.61
124 0.65