Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9IRL1

Protein Details
Accession W9IRL1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-35SAWTTTYTRIPKKQPKALRFLSHydrophilic
NLS Segment(s)
PositionSequence
104-109SGRSHK
Subcellular Location(s) nucl 11.5, cyto_nucl 8.333, mito 8, cyto 4, extr 3
Family & Domain DBs
Amino Acid Sequences MSRSSVYSDDSRSSAWTTTYTRIPKKQPKALRFLSWVAGAPPGATAVKKRTRDYRDDRSVSSGGSTFSNWDQSDTQLSWVVHPNSYYYSGSSRSSTGSGHSKRSGRSHKSGGGSRKHFDGAVPRPVVQPMNMNGGPPPQHPPPPPMAPPMDGGYDGGPGYDAGYGDGIYDEGYDPNFGGGPPPAPMMGGYGGPPPPHMPPPPPMHPQMPGGMPGGAPFIDLTGQNHPGGRGGPSSESDGWSSEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.22
4 0.23
5 0.25
6 0.33
7 0.39
8 0.45
9 0.51
10 0.61
11 0.67
12 0.73
13 0.79
14 0.81
15 0.8
16 0.81
17 0.79
18 0.75
19 0.69
20 0.62
21 0.55
22 0.46
23 0.39
24 0.31
25 0.26
26 0.19
27 0.14
28 0.12
29 0.11
30 0.1
31 0.1
32 0.12
33 0.2
34 0.28
35 0.33
36 0.38
37 0.46
38 0.52
39 0.61
40 0.66
41 0.69
42 0.71
43 0.69
44 0.66
45 0.62
46 0.56
47 0.46
48 0.39
49 0.29
50 0.2
51 0.17
52 0.15
53 0.12
54 0.12
55 0.17
56 0.16
57 0.17
58 0.17
59 0.17
60 0.21
61 0.19
62 0.2
63 0.19
64 0.19
65 0.18
66 0.24
67 0.24
68 0.21
69 0.21
70 0.2
71 0.18
72 0.21
73 0.19
74 0.14
75 0.15
76 0.17
77 0.18
78 0.18
79 0.17
80 0.15
81 0.16
82 0.14
83 0.16
84 0.22
85 0.24
86 0.27
87 0.31
88 0.32
89 0.34
90 0.43
91 0.49
92 0.46
93 0.49
94 0.49
95 0.5
96 0.52
97 0.54
98 0.53
99 0.52
100 0.49
101 0.44
102 0.41
103 0.37
104 0.32
105 0.27
106 0.28
107 0.24
108 0.27
109 0.27
110 0.26
111 0.26
112 0.27
113 0.26
114 0.19
115 0.17
116 0.12
117 0.18
118 0.17
119 0.17
120 0.16
121 0.18
122 0.18
123 0.16
124 0.2
125 0.16
126 0.21
127 0.22
128 0.25
129 0.28
130 0.31
131 0.32
132 0.31
133 0.3
134 0.26
135 0.27
136 0.25
137 0.2
138 0.16
139 0.15
140 0.12
141 0.11
142 0.09
143 0.07
144 0.06
145 0.05
146 0.05
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.06
163 0.06
164 0.05
165 0.06
166 0.07
167 0.07
168 0.08
169 0.09
170 0.08
171 0.08
172 0.08
173 0.09
174 0.09
175 0.09
176 0.09
177 0.11
178 0.12
179 0.12
180 0.13
181 0.13
182 0.16
183 0.21
184 0.23
185 0.24
186 0.3
187 0.37
188 0.43
189 0.46
190 0.47
191 0.45
192 0.45
193 0.44
194 0.4
195 0.34
196 0.29
197 0.26
198 0.22
199 0.18
200 0.16
201 0.15
202 0.11
203 0.1
204 0.08
205 0.07
206 0.08
207 0.09
208 0.11
209 0.15
210 0.18
211 0.19
212 0.2
213 0.2
214 0.2
215 0.2
216 0.2
217 0.17
218 0.17
219 0.19
220 0.2
221 0.26
222 0.25
223 0.26
224 0.25
225 0.24