Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9HJT6

Protein Details
Accession W9HJT6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
180-210QSAIKQAGKEKKKHKKQERRLQKREKAADKFBasic
290-311IAKVNKKAEKKDEKDEKKVAKLBasic
NLS Segment(s)
PositionSequence
183-206IKQAGKEKKKHKKQERRLQKREKA
264-308IEKRRRKDLEEVEKDRVRLMEKHGKAIAKVNKKAEKKDEKDEKKV
Subcellular Location(s) mito 14.5, cyto_mito 10.166, nucl 8, cyto_nucl 7.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MERPMLSPSRPILIPSTSITGSLEVTPPYHRAYPPILNSYGISSEEFMAIIDALNIALAEPAPFKAMEVAGDGLGFVPNEIAQGVSLGLGLAAGTGTAATAYFRERKLLERVNRDIFAPKGLVMKTMKDEEVMQQLNTTAKSLDPLLRLREIASEVEVLSFDVEPPVRRSNMLDRISAKQSAIKQAGKEKKKHKKQERRLQKREKAADKFDRPIESIDEHYNSDIESRIEIESKIARLENRIADINIKAEEKLIESSEKKVGEIEKRRRKDLEEVEKDRVRLMEKHGKAIAKVNKKAEKKDEKDEKKVAKLEWIMIRTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.28
4 0.23
5 0.24
6 0.23
7 0.2
8 0.18
9 0.17
10 0.17
11 0.13
12 0.14
13 0.16
14 0.18
15 0.21
16 0.24
17 0.23
18 0.25
19 0.31
20 0.37
21 0.4
22 0.44
23 0.41
24 0.38
25 0.38
26 0.36
27 0.31
28 0.24
29 0.19
30 0.15
31 0.14
32 0.13
33 0.13
34 0.1
35 0.09
36 0.07
37 0.07
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.03
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.07
50 0.07
51 0.07
52 0.09
53 0.09
54 0.09
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.07
61 0.08
62 0.07
63 0.05
64 0.04
65 0.04
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.03
87 0.04
88 0.07
89 0.11
90 0.11
91 0.14
92 0.15
93 0.2
94 0.27
95 0.35
96 0.4
97 0.44
98 0.49
99 0.51
100 0.5
101 0.47
102 0.42
103 0.34
104 0.29
105 0.22
106 0.17
107 0.16
108 0.15
109 0.18
110 0.16
111 0.17
112 0.18
113 0.2
114 0.19
115 0.16
116 0.16
117 0.14
118 0.2
119 0.19
120 0.16
121 0.14
122 0.15
123 0.16
124 0.15
125 0.14
126 0.08
127 0.07
128 0.08
129 0.09
130 0.11
131 0.12
132 0.14
133 0.16
134 0.17
135 0.17
136 0.16
137 0.16
138 0.14
139 0.12
140 0.11
141 0.09
142 0.08
143 0.08
144 0.07
145 0.06
146 0.05
147 0.05
148 0.04
149 0.05
150 0.05
151 0.06
152 0.1
153 0.12
154 0.12
155 0.13
156 0.15
157 0.21
158 0.3
159 0.31
160 0.3
161 0.31
162 0.34
163 0.36
164 0.34
165 0.27
166 0.22
167 0.22
168 0.26
169 0.28
170 0.26
171 0.25
172 0.34
173 0.43
174 0.46
175 0.52
176 0.56
177 0.62
178 0.71
179 0.8
180 0.82
181 0.84
182 0.89
183 0.92
184 0.93
185 0.94
186 0.94
187 0.94
188 0.91
189 0.89
190 0.87
191 0.85
192 0.8
193 0.77
194 0.76
195 0.7
196 0.67
197 0.6
198 0.53
199 0.45
200 0.4
201 0.35
202 0.27
203 0.25
204 0.23
205 0.22
206 0.2
207 0.19
208 0.18
209 0.15
210 0.14
211 0.12
212 0.09
213 0.08
214 0.09
215 0.09
216 0.1
217 0.1
218 0.12
219 0.13
220 0.14
221 0.15
222 0.15
223 0.15
224 0.17
225 0.22
226 0.22
227 0.22
228 0.23
229 0.22
230 0.22
231 0.23
232 0.21
233 0.19
234 0.17
235 0.14
236 0.14
237 0.14
238 0.13
239 0.14
240 0.14
241 0.17
242 0.18
243 0.21
244 0.25
245 0.25
246 0.23
247 0.25
248 0.29
249 0.34
250 0.43
251 0.51
252 0.56
253 0.61
254 0.66
255 0.66
256 0.65
257 0.65
258 0.66
259 0.66
260 0.66
261 0.67
262 0.7
263 0.7
264 0.66
265 0.57
266 0.49
267 0.42
268 0.35
269 0.38
270 0.4
271 0.39
272 0.45
273 0.47
274 0.47
275 0.44
276 0.5
277 0.51
278 0.5
279 0.55
280 0.59
281 0.63
282 0.67
283 0.74
284 0.76
285 0.77
286 0.74
287 0.78
288 0.8
289 0.8
290 0.83
291 0.84
292 0.81
293 0.78
294 0.77
295 0.67
296 0.65
297 0.59
298 0.58
299 0.56