Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1H1C1

Protein Details
Accession C1H1C1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-83TTTTHRSPRMHRHGLRRTRVBasic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 8, extr 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pbl:PAAG_04565  -  
Amino Acid Sequences MGAVLSCIQDGLRAIGGCLMAIVNGIGNILMAIVSGIVSIFNAIISCLTCGSFRRRRSHMTMGTTTTHRSPRMHRHGLRRTRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.11
5 0.1
6 0.08
7 0.05
8 0.05
9 0.05
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.03
33 0.04
34 0.04
35 0.05
36 0.06
37 0.08
38 0.17
39 0.24
40 0.31
41 0.38
42 0.42
43 0.48
44 0.55
45 0.62
46 0.61
47 0.6
48 0.57
49 0.53
50 0.52
51 0.48
52 0.43
53 0.38
54 0.35
55 0.32
56 0.33
57 0.38
58 0.46
59 0.54
60 0.62
61 0.65
62 0.71
63 0.78