Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9HM11

Protein Details
Accession W9HM11   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
94-113QEERTYRSLKNLRKGRRFPLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8.333, cyto 8, nucl 7.5, cyto_pero 6.833, pero 4.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024079  MetalloPept_cat_dom_sf  
IPR008754  Peptidase_M43  
Gene Ontology GO:0008237  F:metallopeptidase activity  
Pfam View protein in Pfam  
PF05572  Peptidase_M43  
Amino Acid Sequences MPGGPGGPWISRDDDKDKTTTHEVDHWFGLFQIFGGYSCTGNGDFIDDTPAILEASVGCPKGADSCPDQPGLDPIHNYMDYSIHDCISEFTPWQEERTYRSLKNLRKGRRFPLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.37
4 0.36
5 0.36
6 0.39
7 0.36
8 0.33
9 0.34
10 0.34
11 0.34
12 0.34
13 0.28
14 0.22
15 0.21
16 0.18
17 0.11
18 0.08
19 0.06
20 0.05
21 0.05
22 0.07
23 0.08
24 0.08
25 0.08
26 0.09
27 0.08
28 0.09
29 0.08
30 0.08
31 0.07
32 0.07
33 0.1
34 0.08
35 0.08
36 0.08
37 0.08
38 0.06
39 0.06
40 0.06
41 0.03
42 0.05
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.1
49 0.1
50 0.1
51 0.13
52 0.17
53 0.19
54 0.2
55 0.2
56 0.17
57 0.2
58 0.2
59 0.18
60 0.14
61 0.14
62 0.17
63 0.17
64 0.16
65 0.14
66 0.13
67 0.13
68 0.16
69 0.15
70 0.12
71 0.12
72 0.12
73 0.13
74 0.14
75 0.14
76 0.11
77 0.12
78 0.17
79 0.18
80 0.2
81 0.22
82 0.21
83 0.25
84 0.32
85 0.37
86 0.33
87 0.42
88 0.49
89 0.53
90 0.62
91 0.66
92 0.7
93 0.75
94 0.8