Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6R423

Protein Details
Accession W6R423   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-38VESPIKQEQLRKRRIKQEQLRKRRNNLLRRHNDFWHydrophilic
NLS Segment(s)
PositionSequence
14-28RKRRIKQEQLRKRRN
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MAPVESPIKQEQLRKRRIKQEQLRKRRNNLLRRHNDFWRLYSIKSWVVMEMPNGRLYTYYSHPDVAVPTKQEIAQRPQPAVHKSPPDYGPHESANEAIPKLPAITVLGRCNELWSTLSHYITR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.78
4 0.85
5 0.87
6 0.88
7 0.89
8 0.89
9 0.91
10 0.93
11 0.91
12 0.88
13 0.88
14 0.86
15 0.84
16 0.83
17 0.83
18 0.83
19 0.82
20 0.8
21 0.75
22 0.73
23 0.66
24 0.58
25 0.55
26 0.46
27 0.38
28 0.35
29 0.33
30 0.26
31 0.25
32 0.23
33 0.15
34 0.14
35 0.14
36 0.14
37 0.14
38 0.14
39 0.15
40 0.14
41 0.14
42 0.13
43 0.14
44 0.15
45 0.14
46 0.16
47 0.15
48 0.15
49 0.15
50 0.15
51 0.15
52 0.15
53 0.14
54 0.12
55 0.12
56 0.13
57 0.14
58 0.17
59 0.2
60 0.23
61 0.29
62 0.3
63 0.3
64 0.32
65 0.36
66 0.37
67 0.38
68 0.37
69 0.37
70 0.37
71 0.42
72 0.41
73 0.41
74 0.41
75 0.4
76 0.38
77 0.33
78 0.32
79 0.27
80 0.25
81 0.23
82 0.21
83 0.18
84 0.15
85 0.13
86 0.12
87 0.13
88 0.12
89 0.09
90 0.1
91 0.14
92 0.17
93 0.21
94 0.22
95 0.24
96 0.24
97 0.26
98 0.24
99 0.21
100 0.18
101 0.16
102 0.22
103 0.25