Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6R4R8

Protein Details
Accession W6R4R8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
177-203REEKESEDKKKKPTKEEKKLTGRQLWEBasic
NLS Segment(s)
PositionSequence
184-195DKKKKPTKEEKK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040213  GIR2-like  
IPR006575  RWD-domain  
IPR016135  UBQ-conjugating_enzyme/RWD  
Pfam View protein in Pfam  
PF05773  RWD  
PROSITE View protein in PROSITE  
PS50908  RWD  
Amino Acid Sequences MGREDQIEEREVLDSIFPDEISDISETSYRVSITLDALEYDGDETEQPVICLEVSYPEEYPDVGPNLSISSPPNASKHPRLDVQEDRDLLMESLQPTIEENLGMPMIFTLVSALKESAELLMSERADAIQAEMDQVAAKREEEENRKFNGTAVTVKSFLEWSAKFKKEQEEEELRVREEKESEDKKKKPTKEEKKLTGRQLWERGLVKGDYDEEGDDALPAVEKLSVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.1
5 0.09
6 0.09
7 0.09
8 0.1
9 0.11
10 0.09
11 0.09
12 0.11
13 0.11
14 0.12
15 0.13
16 0.11
17 0.11
18 0.12
19 0.12
20 0.11
21 0.13
22 0.11
23 0.1
24 0.1
25 0.1
26 0.09
27 0.08
28 0.07
29 0.06
30 0.06
31 0.06
32 0.08
33 0.08
34 0.08
35 0.07
36 0.08
37 0.07
38 0.07
39 0.07
40 0.09
41 0.11
42 0.12
43 0.12
44 0.13
45 0.13
46 0.13
47 0.14
48 0.13
49 0.13
50 0.11
51 0.11
52 0.1
53 0.11
54 0.11
55 0.11
56 0.09
57 0.1
58 0.12
59 0.15
60 0.16
61 0.19
62 0.25
63 0.31
64 0.34
65 0.36
66 0.38
67 0.39
68 0.44
69 0.46
70 0.47
71 0.45
72 0.4
73 0.37
74 0.33
75 0.3
76 0.23
77 0.17
78 0.13
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.08
85 0.07
86 0.06
87 0.05
88 0.06
89 0.06
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.03
96 0.03
97 0.04
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.04
107 0.05
108 0.07
109 0.07
110 0.07
111 0.07
112 0.06
113 0.06
114 0.06
115 0.05
116 0.04
117 0.04
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.07
127 0.1
128 0.16
129 0.23
130 0.29
131 0.32
132 0.34
133 0.36
134 0.34
135 0.33
136 0.3
137 0.25
138 0.23
139 0.22
140 0.22
141 0.21
142 0.21
143 0.2
144 0.17
145 0.16
146 0.17
147 0.15
148 0.18
149 0.26
150 0.29
151 0.3
152 0.33
153 0.41
154 0.4
155 0.43
156 0.45
157 0.44
158 0.46
159 0.52
160 0.5
161 0.43
162 0.41
163 0.38
164 0.32
165 0.26
166 0.26
167 0.29
168 0.36
169 0.45
170 0.52
171 0.56
172 0.64
173 0.72
174 0.75
175 0.76
176 0.78
177 0.8
178 0.82
179 0.87
180 0.87
181 0.89
182 0.9
183 0.87
184 0.83
185 0.79
186 0.76
187 0.73
188 0.66
189 0.62
190 0.56
191 0.49
192 0.46
193 0.39
194 0.32
195 0.26
196 0.25
197 0.19
198 0.18
199 0.17
200 0.13
201 0.13
202 0.12
203 0.1
204 0.09
205 0.08
206 0.07
207 0.06
208 0.06
209 0.06