Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6PTX6

Protein Details
Accession W6PTX6    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
167-192TPDTDRRRCHGQHRLVRPERRSRSLSBasic
NLS Segment(s)
Subcellular Location(s) nucl 9, mito 6, extr 4, cyto_mito 4, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021829  DUF3419  
Pfam View protein in Pfam  
PF11899  DUF3419  
Amino Acid Sequences MMTCPFQQWISFIFGCRAAFRDFLATKTLNEQRGIWPNRIRPALLSKLVCKLVVSQESFLWAALGVPKNQLAMIESEAVSGPNPTDRKTRSHAIWKYMVDTFDPVADQTHIGADNPSYQVCMTGAFTRRCHPDYLPRKAHAKLSSPGALDGLRIHTDDVNEVLNYITPDTDRRRCHGQHRLVRPERRSRSLSEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.24
5 0.19
6 0.19
7 0.19
8 0.25
9 0.23
10 0.23
11 0.27
12 0.25
13 0.24
14 0.31
15 0.36
16 0.31
17 0.32
18 0.32
19 0.33
20 0.43
21 0.45
22 0.44
23 0.45
24 0.47
25 0.53
26 0.53
27 0.47
28 0.39
29 0.43
30 0.43
31 0.42
32 0.39
33 0.34
34 0.37
35 0.38
36 0.34
37 0.28
38 0.24
39 0.24
40 0.27
41 0.26
42 0.22
43 0.21
44 0.23
45 0.23
46 0.2
47 0.14
48 0.09
49 0.08
50 0.11
51 0.12
52 0.11
53 0.11
54 0.12
55 0.12
56 0.12
57 0.12
58 0.08
59 0.08
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.09
66 0.08
67 0.07
68 0.06
69 0.09
70 0.1
71 0.11
72 0.17
73 0.19
74 0.23
75 0.28
76 0.32
77 0.32
78 0.41
79 0.43
80 0.42
81 0.44
82 0.4
83 0.38
84 0.35
85 0.31
86 0.21
87 0.19
88 0.14
89 0.1
90 0.09
91 0.07
92 0.07
93 0.07
94 0.06
95 0.05
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.08
103 0.08
104 0.07
105 0.07
106 0.08
107 0.07
108 0.08
109 0.08
110 0.12
111 0.18
112 0.2
113 0.22
114 0.26
115 0.3
116 0.31
117 0.32
118 0.3
119 0.35
120 0.42
121 0.51
122 0.53
123 0.51
124 0.54
125 0.53
126 0.58
127 0.52
128 0.48
129 0.41
130 0.4
131 0.41
132 0.37
133 0.35
134 0.29
135 0.25
136 0.2
137 0.17
138 0.15
139 0.12
140 0.12
141 0.13
142 0.13
143 0.13
144 0.14
145 0.14
146 0.12
147 0.11
148 0.11
149 0.1
150 0.1
151 0.1
152 0.1
153 0.09
154 0.08
155 0.15
156 0.22
157 0.3
158 0.33
159 0.37
160 0.45
161 0.5
162 0.59
163 0.64
164 0.67
165 0.69
166 0.75
167 0.81
168 0.82
169 0.86
170 0.85
171 0.85
172 0.83
173 0.81
174 0.75