Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Q0U2

Protein Details
Accession W6Q0U2   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-36RSKHVTSKIKLIRQKQCRRKTSLMKKACEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MAAIKATRSKHVTSKIKLIRQKQCRRKTSLMKKACEYSRMCSADVCVGIRMRETGQVHILSADASGFWAFLTSQLSSHYPTPTVMTDRDLEKTREETVFREQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.68
4 0.72
5 0.74
6 0.74
7 0.75
8 0.82
9 0.82
10 0.84
11 0.83
12 0.84
13 0.84
14 0.85
15 0.85
16 0.85
17 0.83
18 0.77
19 0.72
20 0.71
21 0.63
22 0.58
23 0.49
24 0.43
25 0.43
26 0.41
27 0.37
28 0.3
29 0.29
30 0.25
31 0.23
32 0.2
33 0.12
34 0.11
35 0.1
36 0.11
37 0.1
38 0.08
39 0.13
40 0.13
41 0.13
42 0.15
43 0.15
44 0.15
45 0.14
46 0.14
47 0.09
48 0.08
49 0.06
50 0.03
51 0.04
52 0.04
53 0.03
54 0.03
55 0.04
56 0.04
57 0.05
58 0.07
59 0.07
60 0.08
61 0.1
62 0.12
63 0.14
64 0.16
65 0.16
66 0.15
67 0.16
68 0.18
69 0.18
70 0.2
71 0.19
72 0.19
73 0.21
74 0.22
75 0.27
76 0.28
77 0.27
78 0.28
79 0.3
80 0.31
81 0.32
82 0.32
83 0.3