Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6PVL3

Protein Details
Accession W6PVL3    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-106TFSPSRRVQKRRHGYLARKKDRNGRKTLIRRTLKGRKEBasic
NLS Segment(s)
PositionSequence
73-105SRRVQKRRHGYLARKKDRNGRKTLIRRTLKGRK
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLSSRSFSSLLSTPTRFQPSRTIGGRLSSPTTTATATAFSPLSSLLSQKTPSQRRSFSASASLGVRRVTFSPSRRVQKRRHGYLARKKDRNGRKTLIRRTLKGRKELSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.38
4 0.37
5 0.42
6 0.41
7 0.47
8 0.47
9 0.45
10 0.38
11 0.4
12 0.4
13 0.33
14 0.31
15 0.23
16 0.21
17 0.19
18 0.19
19 0.17
20 0.15
21 0.13
22 0.11
23 0.1
24 0.11
25 0.1
26 0.08
27 0.08
28 0.07
29 0.09
30 0.08
31 0.08
32 0.08
33 0.1
34 0.11
35 0.15
36 0.23
37 0.28
38 0.33
39 0.38
40 0.39
41 0.4
42 0.46
43 0.43
44 0.35
45 0.34
46 0.29
47 0.25
48 0.24
49 0.22
50 0.16
51 0.16
52 0.15
53 0.11
54 0.11
55 0.14
56 0.19
57 0.21
58 0.29
59 0.36
60 0.45
61 0.53
62 0.6
63 0.65
64 0.7
65 0.78
66 0.77
67 0.8
68 0.8
69 0.82
70 0.85
71 0.88
72 0.87
73 0.83
74 0.79
75 0.79
76 0.8
77 0.78
78 0.75
79 0.72
80 0.72
81 0.76
82 0.82
83 0.83
84 0.8
85 0.77
86 0.78
87 0.81
88 0.77
89 0.77