Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6R559

Protein Details
Accession W6R559   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-86DVYRPYQRERSRSPRRRSSRSPPRRARRSYSPRSRSRSRGBasic
NLS Segment(s)
PositionSequence
54-100RERSRSPRRRSSRSPPRRARRSYSPRSRSRSRGDREEYRRPERRSRS
Subcellular Location(s) extr 10, plas 6, mito 5, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MGTFSRVLWIITLCFFVSLYYSFVTLICLVHSKGPRFSADSLIRPADVYRPYQRERSRSPRRRSSRSPPRRARRSYSPRSRSRSRGDREEYRRPERRSRSPLSASGAATGPPGSGSPFGGRSGYTPARFEDRAAKENMMQTVRDSSQQDRRVYVGNLSYDVKWHHLKDFMRQAGEVLFADVLLLPNGMSKVGDCGICNQGPSTKRREYAQQPEPDGSPCLCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.11
5 0.11
6 0.12
7 0.11
8 0.11
9 0.11
10 0.11
11 0.12
12 0.11
13 0.1
14 0.1
15 0.11
16 0.12
17 0.18
18 0.23
19 0.24
20 0.27
21 0.3
22 0.31
23 0.33
24 0.34
25 0.37
26 0.36
27 0.37
28 0.37
29 0.36
30 0.33
31 0.3
32 0.29
33 0.25
34 0.23
35 0.24
36 0.28
37 0.33
38 0.36
39 0.45
40 0.5
41 0.52
42 0.59
43 0.65
44 0.68
45 0.72
46 0.79
47 0.8
48 0.84
49 0.85
50 0.85
51 0.85
52 0.85
53 0.86
54 0.88
55 0.88
56 0.89
57 0.9
58 0.88
59 0.84
60 0.84
61 0.83
62 0.83
63 0.83
64 0.82
65 0.81
66 0.82
67 0.81
68 0.77
69 0.76
70 0.75
71 0.7
72 0.7
73 0.68
74 0.7
75 0.71
76 0.74
77 0.72
78 0.71
79 0.74
80 0.69
81 0.72
82 0.7
83 0.72
84 0.7
85 0.68
86 0.66
87 0.61
88 0.59
89 0.54
90 0.49
91 0.39
92 0.32
93 0.27
94 0.2
95 0.16
96 0.13
97 0.08
98 0.05
99 0.05
100 0.05
101 0.05
102 0.06
103 0.06
104 0.07
105 0.08
106 0.08
107 0.08
108 0.09
109 0.15
110 0.17
111 0.17
112 0.17
113 0.18
114 0.22
115 0.22
116 0.23
117 0.26
118 0.26
119 0.29
120 0.3
121 0.29
122 0.27
123 0.29
124 0.32
125 0.24
126 0.2
127 0.17
128 0.19
129 0.19
130 0.21
131 0.2
132 0.22
133 0.29
134 0.36
135 0.36
136 0.34
137 0.34
138 0.34
139 0.33
140 0.31
141 0.26
142 0.2
143 0.21
144 0.21
145 0.2
146 0.18
147 0.19
148 0.2
149 0.21
150 0.21
151 0.22
152 0.26
153 0.28
154 0.34
155 0.43
156 0.42
157 0.39
158 0.37
159 0.36
160 0.3
161 0.31
162 0.22
163 0.13
164 0.1
165 0.08
166 0.08
167 0.08
168 0.07
169 0.06
170 0.06
171 0.04
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.09
178 0.11
179 0.12
180 0.11
181 0.15
182 0.21
183 0.21
184 0.22
185 0.2
186 0.24
187 0.28
188 0.32
189 0.36
190 0.37
191 0.4
192 0.42
193 0.51
194 0.55
195 0.61
196 0.66
197 0.66
198 0.64
199 0.63
200 0.62
201 0.55
202 0.48