Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2UYW5

Protein Details
Accession A0A0A2UYW5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-80QLEKARKKARAKEKLSPISHHydrophilic
NLS Segment(s)
PositionSequence
64-74KARKKARAKEK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cysk 7, cyto 3.5
Family & Domain DBs
KEGG pbl:PAAG_12567  -  
Amino Acid Sequences MSQLGSGYRDTIPCALEEFCVDDEQAAHCILTRQPQPRPISITRQSHARRGTTVMILHGSQLEKARKKARAKEKLSPISHEPHESSSNAPAPIKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.14
5 0.14
6 0.13
7 0.13
8 0.12
9 0.1
10 0.1
11 0.11
12 0.12
13 0.09
14 0.08
15 0.07
16 0.09
17 0.1
18 0.16
19 0.21
20 0.25
21 0.28
22 0.35
23 0.38
24 0.39
25 0.45
26 0.42
27 0.44
28 0.47
29 0.49
30 0.42
31 0.49
32 0.48
33 0.47
34 0.47
35 0.39
36 0.33
37 0.3
38 0.31
39 0.24
40 0.22
41 0.17
42 0.15
43 0.14
44 0.13
45 0.12
46 0.11
47 0.1
48 0.15
49 0.21
50 0.23
51 0.3
52 0.36
53 0.43
54 0.51
55 0.59
56 0.65
57 0.68
58 0.72
59 0.76
60 0.79
61 0.81
62 0.76
63 0.72
64 0.65
65 0.61
66 0.56
67 0.51
68 0.42
69 0.37
70 0.37
71 0.33
72 0.31
73 0.31
74 0.32
75 0.31