Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6PTN7

Protein Details
Accession W6PTN7   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-111GLDVPSHKKKRNKAKANKATTKDMHydrophilic
NLS Segment(s)
PositionSequence
93-105SHKKKRNKAKANK
Subcellular Location(s) cyto 15.5, cyto_nucl 14.5, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MEENLQSLTAGKVQELLIICGIGDCNDEPIKQHILGISDFVREMRLRVGITDLPPLLTPRASPNPEATRGSYRFLPTPEKRSRADYKGLDVPSHKKKRNKAKANKATTKDMAQEADDAVAVREGDIPAEPPSTAEANAAMSIPQAGMSTDMYTYRGEKAPHSIVENILVNCIKLNDPLGRYGHRSKQANMTTKVKEIQSFVDDIVKLQYPDAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.14
5 0.14
6 0.13
7 0.11
8 0.12
9 0.08
10 0.09
11 0.07
12 0.11
13 0.13
14 0.13
15 0.15
16 0.19
17 0.22
18 0.2
19 0.21
20 0.19
21 0.2
22 0.2
23 0.21
24 0.17
25 0.14
26 0.15
27 0.14
28 0.15
29 0.12
30 0.13
31 0.12
32 0.14
33 0.13
34 0.14
35 0.17
36 0.17
37 0.18
38 0.21
39 0.19
40 0.17
41 0.17
42 0.18
43 0.16
44 0.13
45 0.13
46 0.16
47 0.24
48 0.25
49 0.26
50 0.32
51 0.35
52 0.39
53 0.4
54 0.37
55 0.37
56 0.36
57 0.37
58 0.33
59 0.3
60 0.29
61 0.3
62 0.36
63 0.32
64 0.4
65 0.44
66 0.46
67 0.45
68 0.5
69 0.53
70 0.48
71 0.52
72 0.44
73 0.41
74 0.43
75 0.42
76 0.37
77 0.33
78 0.35
79 0.38
80 0.46
81 0.48
82 0.48
83 0.56
84 0.66
85 0.75
86 0.79
87 0.79
88 0.81
89 0.85
90 0.88
91 0.88
92 0.8
93 0.74
94 0.64
95 0.56
96 0.46
97 0.37
98 0.28
99 0.2
100 0.17
101 0.12
102 0.11
103 0.09
104 0.07
105 0.05
106 0.05
107 0.05
108 0.04
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.07
115 0.08
116 0.07
117 0.07
118 0.09
119 0.09
120 0.09
121 0.08
122 0.08
123 0.08
124 0.08
125 0.08
126 0.06
127 0.05
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.05
134 0.06
135 0.07
136 0.07
137 0.07
138 0.09
139 0.09
140 0.11
141 0.12
142 0.15
143 0.16
144 0.17
145 0.22
146 0.25
147 0.26
148 0.28
149 0.26
150 0.23
151 0.26
152 0.28
153 0.22
154 0.21
155 0.2
156 0.17
157 0.16
158 0.16
159 0.13
160 0.11
161 0.14
162 0.16
163 0.17
164 0.22
165 0.24
166 0.26
167 0.32
168 0.37
169 0.42
170 0.47
171 0.49
172 0.48
173 0.55
174 0.61
175 0.64
176 0.63
177 0.62
178 0.56
179 0.57
180 0.58
181 0.51
182 0.45
183 0.38
184 0.36
185 0.32
186 0.3
187 0.27
188 0.28
189 0.25
190 0.23
191 0.24
192 0.23
193 0.2