Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Q165

Protein Details
Accession W6Q165   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-25LPTSTHSCRHRFKRPSNILVAEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF00646  F-box  
CDD cd09917  F-box_SF  
Amino Acid Sequences MSALPTSTHSCRHRFKRPSNILVAEPQITCNLLSLPPELIVDILNKCEHLDRMCLALTCKRLLHVSSLVRIRIPSVPKHRFLPPSTCVDIFTLLRRIAPRDNSGRPEANIGLCCDCLRYRTRRIQYWDGYEDKYLEMGVEPEMWDNAVSHWHSKYYFQCPECWCRETFRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.8
4 0.84
5 0.84
6 0.82
7 0.76
8 0.68
9 0.62
10 0.55
11 0.46
12 0.36
13 0.29
14 0.22
15 0.19
16 0.17
17 0.13
18 0.12
19 0.1
20 0.11
21 0.11
22 0.11
23 0.11
24 0.11
25 0.1
26 0.09
27 0.09
28 0.1
29 0.09
30 0.1
31 0.1
32 0.1
33 0.11
34 0.12
35 0.13
36 0.13
37 0.14
38 0.13
39 0.15
40 0.16
41 0.16
42 0.16
43 0.18
44 0.19
45 0.19
46 0.18
47 0.17
48 0.18
49 0.18
50 0.2
51 0.21
52 0.21
53 0.24
54 0.26
55 0.25
56 0.24
57 0.23
58 0.21
59 0.2
60 0.21
61 0.23
62 0.31
63 0.35
64 0.37
65 0.4
66 0.43
67 0.43
68 0.43
69 0.42
70 0.35
71 0.36
72 0.36
73 0.33
74 0.29
75 0.25
76 0.24
77 0.18
78 0.17
79 0.15
80 0.13
81 0.14
82 0.14
83 0.16
84 0.18
85 0.21
86 0.24
87 0.27
88 0.31
89 0.33
90 0.36
91 0.35
92 0.32
93 0.32
94 0.28
95 0.24
96 0.21
97 0.19
98 0.16
99 0.15
100 0.15
101 0.13
102 0.12
103 0.13
104 0.18
105 0.22
106 0.3
107 0.39
108 0.46
109 0.52
110 0.6
111 0.65
112 0.65
113 0.65
114 0.62
115 0.56
116 0.5
117 0.44
118 0.37
119 0.28
120 0.23
121 0.16
122 0.11
123 0.09
124 0.08
125 0.07
126 0.07
127 0.07
128 0.08
129 0.08
130 0.08
131 0.08
132 0.08
133 0.07
134 0.12
135 0.14
136 0.16
137 0.17
138 0.2
139 0.21
140 0.26
141 0.32
142 0.36
143 0.43
144 0.41
145 0.47
146 0.5
147 0.58
148 0.58
149 0.55
150 0.47
151 0.46