Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6QUT8

Protein Details
Accession W6QUT8   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-30EDPLSRGETPKNKKKRNPSFRRYLRDHGIBasic
39-68VRDPALPLKRKRNHRRYRQKKAKKIETEAABasic
NLS Segment(s)
PositionSequence
12-19KNKKKRNP
45-62PLKRKRNHRRYRQKKAKK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MEDPLSRGETPKNKKKRNPSFRRYLRDHGIDVPSLVQGVRDPALPLKRKRNHRRYRQKKAKKIETEAAAATQKNEVAESADSSAIAKRSFCLISPVTAPSPAAPSHATPSPSKPSPSPAVTSPENVTLPIRGLRNPYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.85
3 0.88
4 0.9
5 0.91
6 0.9
7 0.9
8 0.9
9 0.9
10 0.86
11 0.83
12 0.79
13 0.73
14 0.66
15 0.6
16 0.52
17 0.43
18 0.36
19 0.29
20 0.21
21 0.17
22 0.14
23 0.09
24 0.06
25 0.08
26 0.08
27 0.08
28 0.09
29 0.13
30 0.21
31 0.27
32 0.33
33 0.42
34 0.49
35 0.6
36 0.7
37 0.77
38 0.8
39 0.84
40 0.9
41 0.9
42 0.94
43 0.95
44 0.94
45 0.93
46 0.92
47 0.91
48 0.87
49 0.82
50 0.76
51 0.67
52 0.58
53 0.49
54 0.4
55 0.31
56 0.24
57 0.18
58 0.13
59 0.1
60 0.08
61 0.08
62 0.06
63 0.07
64 0.07
65 0.07
66 0.08
67 0.07
68 0.07
69 0.08
70 0.09
71 0.09
72 0.09
73 0.08
74 0.08
75 0.11
76 0.11
77 0.11
78 0.15
79 0.14
80 0.15
81 0.17
82 0.19
83 0.17
84 0.17
85 0.17
86 0.12
87 0.14
88 0.13
89 0.14
90 0.13
91 0.13
92 0.17
93 0.2
94 0.22
95 0.21
96 0.27
97 0.32
98 0.34
99 0.36
100 0.33
101 0.37
102 0.41
103 0.42
104 0.4
105 0.36
106 0.39
107 0.37
108 0.39
109 0.35
110 0.33
111 0.3
112 0.28
113 0.26
114 0.21
115 0.22
116 0.23
117 0.23
118 0.21