Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6PQC8

Protein Details
Accession W6PQC8    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-62ARVKTEPEKNRRRNENRWGEATPHPHCSARTGRQNPRRHRGGRBasic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MARTNQPKRQRTFLQWCLHARVKTEPEKNRRRNENRWGEATPHPHCSARTGRQNPRRHRGGRIYQCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.71
3 0.68
4 0.66
5 0.65
6 0.56
7 0.48
8 0.46
9 0.45
10 0.46
11 0.52
12 0.53
13 0.57
14 0.67
15 0.73
16 0.75
17 0.79
18 0.79
19 0.79
20 0.81
21 0.81
22 0.74
23 0.69
24 0.62
25 0.55
26 0.52
27 0.5
28 0.43
29 0.37
30 0.35
31 0.32
32 0.31
33 0.32
34 0.36
35 0.37
36 0.45
37 0.5
38 0.59
39 0.67
40 0.76
41 0.81
42 0.82
43 0.83
44 0.76
45 0.77
46 0.77
47 0.78