Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6QWF1

Protein Details
Accession W6QWF1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-27SHSPSGRTNKRKRGAPDPYKKPBasic
NLS Segment(s)
PositionSequence
14-21NKRKRGAP
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MDAPASHSPSGRTNKRKRGAPDPYKKPVGIPGSTKQVTKTISIGAEYYMIKSAGKIRLEEEHRFLQGSNKWLVGENEKLQECYNNQELLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.8
4 0.78
5 0.79
6 0.8
7 0.81
8 0.81
9 0.79
10 0.79
11 0.75
12 0.69
13 0.59
14 0.55
15 0.49
16 0.41
17 0.37
18 0.33
19 0.37
20 0.38
21 0.38
22 0.32
23 0.3
24 0.29
25 0.25
26 0.22
27 0.16
28 0.15
29 0.15
30 0.14
31 0.11
32 0.11
33 0.1
34 0.09
35 0.08
36 0.08
37 0.07
38 0.08
39 0.12
40 0.16
41 0.17
42 0.17
43 0.18
44 0.25
45 0.3
46 0.32
47 0.32
48 0.29
49 0.29
50 0.29
51 0.28
52 0.27
53 0.26
54 0.27
55 0.24
56 0.22
57 0.22
58 0.24
59 0.26
60 0.25
61 0.27
62 0.26
63 0.31
64 0.31
65 0.32
66 0.31
67 0.33
68 0.3
69 0.31
70 0.32