Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6Q2K2

Protein Details
Accession W6Q2K2    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-44LCDRHFCRTHRREPWHKCPKPBasic
NLS Segment(s)
Subcellular Location(s) cyto 10cyto_nucl 10, mito 9, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
Amino Acid Sequences MPHWSCEWESCKKPAAQRAGDCLLCDRHFCRTHRREPWHKCPKPEENWESYSAQYTATEAPHIDELCLRID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.53
4 0.52
5 0.55
6 0.54
7 0.5
8 0.44
9 0.38
10 0.33
11 0.27
12 0.26
13 0.21
14 0.24
15 0.29
16 0.31
17 0.39
18 0.42
19 0.51
20 0.58
21 0.66
22 0.69
23 0.72
24 0.81
25 0.82
26 0.78
27 0.74
28 0.73
29 0.72
30 0.69
31 0.7
32 0.65
33 0.59
34 0.58
35 0.56
36 0.49
37 0.41
38 0.36
39 0.27
40 0.22
41 0.16
42 0.15
43 0.14
44 0.13
45 0.14
46 0.11
47 0.13
48 0.17
49 0.17
50 0.16
51 0.15