Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6PY41

Protein Details
Accession W6PY41   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
43-72SETQLRSRLKKWRVTKPSRQTRKKSLASAEHydrophilic
NLS Segment(s)
PositionSequence
51-66LKKWRVTKPSRQTRKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.333, mito_nucl 12.166, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MKTSISSEVWEKKKALISKLYMEDEWPLKQVIKQIRTDDFNPSETQLRSRLKKWRVTKPSRQTRKKSLASAEDLDSDKDAKRKASTIQRPLPSLSTRETQARHEWPMIQPIYAQHPTLQHPVPDRDRKWSSPMIQQLTPSPSGEHIQDRTTAVSYAEHSPTTTPFDQTHTSPVGEGLMLSTTPAVAPSYPAYPLSPESGLPSPGTATTPSSIGWSPRAVPVDYGLNPPQWYSLPFETIPPPAVSQSPAAPMAPSINGYLPHVQLYHPQYYHGEAEYPHVYDSKNWKRTMSLQYDMAGHLAARAEHGDRKQMLPQMQSHGQWHPMSPPPTQSGGPHSLMCAPVMPYMGHDHYVQKPPGIGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.49
4 0.49
5 0.52
6 0.57
7 0.56
8 0.48
9 0.44
10 0.42
11 0.37
12 0.33
13 0.27
14 0.23
15 0.2
16 0.22
17 0.29
18 0.33
19 0.36
20 0.41
21 0.44
22 0.49
23 0.53
24 0.53
25 0.54
26 0.48
27 0.44
28 0.4
29 0.37
30 0.37
31 0.33
32 0.34
33 0.34
34 0.39
35 0.42
36 0.47
37 0.54
38 0.57
39 0.65
40 0.71
41 0.73
42 0.76
43 0.81
44 0.85
45 0.86
46 0.89
47 0.91
48 0.92
49 0.9
50 0.9
51 0.9
52 0.86
53 0.82
54 0.78
55 0.74
56 0.7
57 0.64
58 0.55
59 0.48
60 0.42
61 0.36
62 0.29
63 0.24
64 0.2
65 0.21
66 0.21
67 0.21
68 0.22
69 0.24
70 0.31
71 0.4
72 0.48
73 0.54
74 0.6
75 0.6
76 0.6
77 0.6
78 0.56
79 0.48
80 0.41
81 0.34
82 0.29
83 0.27
84 0.31
85 0.3
86 0.3
87 0.35
88 0.37
89 0.37
90 0.36
91 0.36
92 0.33
93 0.39
94 0.35
95 0.28
96 0.24
97 0.22
98 0.27
99 0.26
100 0.24
101 0.18
102 0.21
103 0.24
104 0.29
105 0.28
106 0.24
107 0.27
108 0.33
109 0.39
110 0.45
111 0.43
112 0.46
113 0.5
114 0.49
115 0.5
116 0.5
117 0.45
118 0.44
119 0.5
120 0.45
121 0.41
122 0.4
123 0.38
124 0.35
125 0.33
126 0.26
127 0.19
128 0.16
129 0.16
130 0.17
131 0.17
132 0.15
133 0.15
134 0.16
135 0.17
136 0.16
137 0.16
138 0.14
139 0.11
140 0.1
141 0.12
142 0.13
143 0.14
144 0.13
145 0.12
146 0.12
147 0.13
148 0.18
149 0.16
150 0.15
151 0.15
152 0.18
153 0.2
154 0.2
155 0.22
156 0.18
157 0.17
158 0.15
159 0.15
160 0.12
161 0.09
162 0.09
163 0.05
164 0.04
165 0.04
166 0.04
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.04
174 0.06
175 0.07
176 0.07
177 0.08
178 0.08
179 0.09
180 0.1
181 0.11
182 0.1
183 0.1
184 0.12
185 0.13
186 0.13
187 0.12
188 0.11
189 0.1
190 0.1
191 0.1
192 0.08
193 0.08
194 0.08
195 0.09
196 0.09
197 0.1
198 0.11
199 0.11
200 0.12
201 0.12
202 0.12
203 0.15
204 0.17
205 0.15
206 0.14
207 0.15
208 0.17
209 0.18
210 0.2
211 0.18
212 0.18
213 0.18
214 0.18
215 0.17
216 0.14
217 0.14
218 0.15
219 0.15
220 0.17
221 0.17
222 0.19
223 0.2
224 0.2
225 0.21
226 0.16
227 0.16
228 0.14
229 0.14
230 0.14
231 0.13
232 0.13
233 0.13
234 0.13
235 0.13
236 0.12
237 0.11
238 0.11
239 0.1
240 0.1
241 0.09
242 0.1
243 0.1
244 0.13
245 0.15
246 0.14
247 0.14
248 0.14
249 0.13
250 0.19
251 0.23
252 0.27
253 0.25
254 0.26
255 0.26
256 0.28
257 0.3
258 0.23
259 0.2
260 0.15
261 0.2
262 0.2
263 0.19
264 0.16
265 0.16
266 0.16
267 0.2
268 0.3
269 0.36
270 0.41
271 0.42
272 0.43
273 0.45
274 0.53
275 0.57
276 0.53
277 0.47
278 0.42
279 0.42
280 0.42
281 0.39
282 0.31
283 0.22
284 0.14
285 0.11
286 0.1
287 0.08
288 0.08
289 0.09
290 0.12
291 0.17
292 0.18
293 0.24
294 0.26
295 0.28
296 0.32
297 0.36
298 0.38
299 0.38
300 0.4
301 0.4
302 0.43
303 0.43
304 0.42
305 0.39
306 0.4
307 0.37
308 0.34
309 0.32
310 0.35
311 0.36
312 0.35
313 0.36
314 0.35
315 0.37
316 0.37
317 0.34
318 0.34
319 0.37
320 0.37
321 0.33
322 0.3
323 0.3
324 0.29
325 0.27
326 0.21
327 0.17
328 0.16
329 0.17
330 0.16
331 0.15
332 0.21
333 0.22
334 0.22
335 0.22
336 0.26
337 0.31
338 0.4
339 0.39
340 0.34