Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6R651

Protein Details
Accession W6R651   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-36RSKDVVSKRKLMRQKQCRRKTSLMKKACEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MAAIKATRSKDVVSKRKLMRQKQCRRKTSLMKKACEYSRMCGADVCVGIRIRETGQVHILSADTSGFWAFLSSQLNSYYPAPMLVTHQDLPQVDKDTPQQPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.66
4 0.73
5 0.76
6 0.76
7 0.77
8 0.82
9 0.84
10 0.89
11 0.87
12 0.87
13 0.86
14 0.86
15 0.86
16 0.85
17 0.83
18 0.77
19 0.72
20 0.71
21 0.63
22 0.58
23 0.49
24 0.42
25 0.42
26 0.38
27 0.35
28 0.28
29 0.27
30 0.23
31 0.21
32 0.18
33 0.12
34 0.11
35 0.1
36 0.1
37 0.1
38 0.08
39 0.13
40 0.14
41 0.12
42 0.15
43 0.15
44 0.15
45 0.14
46 0.14
47 0.09
48 0.08
49 0.07
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.07
58 0.1
59 0.1
60 0.11
61 0.13
62 0.13
63 0.15
64 0.16
65 0.14
66 0.12
67 0.12
68 0.11
69 0.11
70 0.14
71 0.15
72 0.19
73 0.18
74 0.19
75 0.22
76 0.22
77 0.25
78 0.26
79 0.27
80 0.23
81 0.25
82 0.3