Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6Q896

Protein Details
Accession W6Q896    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
60-84DTFIKCPKFDNKKCTKDNNKCTVDTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, cyto 7.5, cyto_nucl 5.5, pero 4, mito 3, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023112  Antifungal-protein_dom_sf  
IPR022706  Antifungal_prot  
Gene Ontology GO:0050832  P:defense response to fungus  
Pfam View protein in Pfam  
PF11402  Antifungal_prot  
Amino Acid Sequences MQITTVALFLFAAMGGVATPIESVSNDLDARAEAGVLAKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.06
11 0.06
12 0.09
13 0.09
14 0.09
15 0.09
16 0.09
17 0.09
18 0.07
19 0.06
20 0.04
21 0.05
22 0.05
23 0.05
24 0.06
25 0.07
26 0.07
27 0.11
28 0.15
29 0.16
30 0.19
31 0.23
32 0.32
33 0.41
34 0.51
35 0.57
36 0.64
37 0.7
38 0.72
39 0.76
40 0.75
41 0.72
42 0.66
43 0.62
44 0.53
45 0.51
46 0.5
47 0.44
48 0.42
49 0.41
50 0.38
51 0.34
52 0.39
53 0.44
54 0.51
55 0.56
56 0.6
57 0.64
58 0.72
59 0.79
60 0.82
61 0.84
62 0.84
63 0.87
64 0.87
65 0.81
66 0.73
67 0.69
68 0.66
69 0.6
70 0.53
71 0.48
72 0.44