Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6R1H1

Protein Details
Accession W6R1H1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
96-115FRTWRIPRSHPPRFLRNLRHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MVHIWDLPAPKVTGPEKKERKNTPASREIRNEKGTVSTPVYQASVSKFSTPKYEATTVRSENLRPASALRAVVADSAVSFSQRRVHGGGSSSRESFRTWRIPRSHPPRFLRNLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.45
3 0.52
4 0.6
5 0.69
6 0.7
7 0.73
8 0.75
9 0.79
10 0.76
11 0.76
12 0.72
13 0.7
14 0.71
15 0.69
16 0.66
17 0.6
18 0.53
19 0.43
20 0.42
21 0.37
22 0.32
23 0.29
24 0.24
25 0.22
26 0.22
27 0.22
28 0.18
29 0.17
30 0.16
31 0.16
32 0.14
33 0.16
34 0.16
35 0.17
36 0.21
37 0.22
38 0.21
39 0.22
40 0.26
41 0.24
42 0.27
43 0.31
44 0.27
45 0.28
46 0.27
47 0.23
48 0.22
49 0.23
50 0.2
51 0.15
52 0.15
53 0.16
54 0.16
55 0.16
56 0.12
57 0.1
58 0.1
59 0.1
60 0.09
61 0.06
62 0.04
63 0.06
64 0.06
65 0.06
66 0.07
67 0.08
68 0.14
69 0.14
70 0.17
71 0.17
72 0.19
73 0.2
74 0.23
75 0.28
76 0.28
77 0.3
78 0.3
79 0.29
80 0.29
81 0.29
82 0.29
83 0.3
84 0.35
85 0.37
86 0.44
87 0.5
88 0.57
89 0.65
90 0.72
91 0.74
92 0.74
93 0.77
94 0.77
95 0.8