Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6PSA7

Protein Details
Accession W6PSA7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-103LQQKYGFKKKGPKGTPRRKKGAAMBasic
NLS Segment(s)
PositionSequence
86-100FKKKGPKGTPRRKKG
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MAPVTDTTSKANGPALPKAKLRIKLNVKPPAKAETEVEALKASDEEFLLTLLDTVKVDHQAAANTLGINKAACRMRFIRLQQKYGFKKKGPKGTPRRKKGAAMVTPANEADVAEGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.33
4 0.36
5 0.42
6 0.45
7 0.5
8 0.51
9 0.52
10 0.57
11 0.6
12 0.67
13 0.7
14 0.65
15 0.6
16 0.59
17 0.54
18 0.47
19 0.41
20 0.34
21 0.27
22 0.29
23 0.26
24 0.24
25 0.19
26 0.16
27 0.15
28 0.12
29 0.09
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.04
39 0.05
40 0.04
41 0.05
42 0.05
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.09
50 0.09
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.06
57 0.1
58 0.13
59 0.13
60 0.17
61 0.19
62 0.22
63 0.29
64 0.35
65 0.4
66 0.42
67 0.47
68 0.48
69 0.56
70 0.61
71 0.65
72 0.66
73 0.61
74 0.66
75 0.69
76 0.74
77 0.72
78 0.74
79 0.76
80 0.81
81 0.86
82 0.85
83 0.86
84 0.8
85 0.78
86 0.76
87 0.75
88 0.7
89 0.66
90 0.63
91 0.56
92 0.53
93 0.47
94 0.39
95 0.28
96 0.21
97 0.16