Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6QPA9

Protein Details
Accession W6QPA9    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-36IKATKSKDTTSKRKLMRQKQCRRKTSLMKKACEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MAAIKATKSKDTTSKRKLMRQKQCRRKTSLMKKACEYSRMCSADVCVGIRIRETGQVHILSADTSGFWAFLSSQLSSYYPAPMLVTDQDVQQVGKDTPQQPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.68
3 0.75
4 0.81
5 0.82
6 0.83
7 0.84
8 0.86
9 0.88
10 0.91
11 0.89
12 0.87
13 0.86
14 0.86
15 0.86
16 0.85
17 0.83
18 0.77
19 0.72
20 0.71
21 0.63
22 0.58
23 0.49
24 0.43
25 0.43
26 0.41
27 0.37
28 0.3
29 0.29
30 0.25
31 0.23
32 0.2
33 0.12
34 0.11
35 0.1
36 0.1
37 0.1
38 0.08
39 0.13
40 0.13
41 0.13
42 0.15
43 0.15
44 0.15
45 0.14
46 0.14
47 0.09
48 0.08
49 0.07
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.06
58 0.09
59 0.09
60 0.09
61 0.11
62 0.12
63 0.13
64 0.14
65 0.14
66 0.12
67 0.12
68 0.12
69 0.11
70 0.12
71 0.11
72 0.14
73 0.13
74 0.13
75 0.15
76 0.15
77 0.15
78 0.14
79 0.16
80 0.13
81 0.17
82 0.24