Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6QR99

Protein Details
Accession W6QR99    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-74HYSTKLRHKASSRSVKPRRREBasic
NLS Segment(s)
PositionSequence
60-74RHKASSRSVKPRRRE
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MLSRPHTAVIPGKLRPYTSYENALLVRLKEKEAMSWSEITAHYPGRNMSSLQVHYSTKLRHKASSRSVKPRRRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.36
4 0.36
5 0.34
6 0.36
7 0.32
8 0.33
9 0.32
10 0.32
11 0.26
12 0.2
13 0.2
14 0.16
15 0.16
16 0.17
17 0.16
18 0.16
19 0.18
20 0.19
21 0.18
22 0.17
23 0.17
24 0.15
25 0.15
26 0.15
27 0.14
28 0.13
29 0.11
30 0.12
31 0.12
32 0.12
33 0.13
34 0.12
35 0.14
36 0.17
37 0.18
38 0.19
39 0.22
40 0.2
41 0.21
42 0.26
43 0.28
44 0.31
45 0.39
46 0.39
47 0.44
48 0.49
49 0.56
50 0.62
51 0.69
52 0.7
53 0.73
54 0.81