Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6QBA6

Protein Details
Accession W6QBA6    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-57VCPFCAKKHSNASRLRKHLCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MENTTDIHPACDCVAHRKDYQHWPKENAEIRIASCMRVCPFCAKKHSNASRLRKHLCSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.3
4 0.33
5 0.39
6 0.46
7 0.55
8 0.56
9 0.56
10 0.57
11 0.56
12 0.6
13 0.59
14 0.5
15 0.42
16 0.34
17 0.3
18 0.3
19 0.28
20 0.21
21 0.16
22 0.16
23 0.16
24 0.16
25 0.17
26 0.21
27 0.26
28 0.3
29 0.39
30 0.41
31 0.47
32 0.56
33 0.64
34 0.64
35 0.69
36 0.74
37 0.75
38 0.8
39 0.8