Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6QRY7

Protein Details
Accession W6QRY7    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
278-301ERDYKPELERKKKEREEQSSSQREBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 10.833, cyto_nucl 9.833, mito 6.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004130  Gpn  
IPR030230  Gpn1/Npa3/XAB1  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF03029  ATP_bind_1  
CDD cd17870  GPN1  
Amino Acid Sequences MASPVAVVCVGMAGSGKTTFMQRINSYLHEKKTVPYVINLDPAVHSVPFESNIDIRDSINYKEVMKQYNLGPNGGILTSLNLFATKVDQIISLLEKRTAPNPENPSATPIKHILVDTPGQIEVFVWSASGSILLETMATSFPTVIAYVIDTPRASSTSTFMSNMLYACSILYKTKLPMILVFNKTDVKDAEFAKEWMTDFDAFQQALRQEEDAGAFGAEGGAGGFGSGSGYMGSLLNSMSLMLEEFYRHLSVVGVSSMTGDGVEEFFEAVETKRQEFERDYKPELERKKKEREEQSSSQRELELGKLMKDMNVSGSSRQPPRKSTEEPETVSEAEDEEDDIIKRGLADGEDSDYEDYVGPNAGNDEGLTQRYQEALAGSQSTPSEQDNSFTRYLRASNMQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.09
5 0.12
6 0.16
7 0.19
8 0.26
9 0.25
10 0.3
11 0.34
12 0.38
13 0.44
14 0.46
15 0.47
16 0.46
17 0.46
18 0.43
19 0.47
20 0.47
21 0.4
22 0.38
23 0.4
24 0.37
25 0.41
26 0.39
27 0.31
28 0.26
29 0.27
30 0.24
31 0.18
32 0.15
33 0.12
34 0.13
35 0.14
36 0.15
37 0.15
38 0.15
39 0.16
40 0.19
41 0.18
42 0.17
43 0.2
44 0.21
45 0.21
46 0.23
47 0.24
48 0.22
49 0.28
50 0.32
51 0.32
52 0.31
53 0.33
54 0.33
55 0.39
56 0.39
57 0.33
58 0.29
59 0.24
60 0.24
61 0.2
62 0.16
63 0.08
64 0.08
65 0.08
66 0.09
67 0.08
68 0.07
69 0.07
70 0.07
71 0.1
72 0.09
73 0.08
74 0.08
75 0.09
76 0.09
77 0.11
78 0.13
79 0.14
80 0.14
81 0.16
82 0.17
83 0.18
84 0.23
85 0.27
86 0.27
87 0.33
88 0.38
89 0.41
90 0.43
91 0.42
92 0.42
93 0.4
94 0.37
95 0.32
96 0.27
97 0.24
98 0.22
99 0.22
100 0.18
101 0.18
102 0.19
103 0.16
104 0.15
105 0.14
106 0.12
107 0.12
108 0.11
109 0.08
110 0.08
111 0.07
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.04
119 0.04
120 0.04
121 0.04
122 0.03
123 0.04
124 0.04
125 0.04
126 0.05
127 0.04
128 0.05
129 0.05
130 0.05
131 0.05
132 0.04
133 0.05
134 0.07
135 0.08
136 0.09
137 0.08
138 0.09
139 0.09
140 0.1
141 0.1
142 0.09
143 0.1
144 0.12
145 0.13
146 0.13
147 0.13
148 0.13
149 0.13
150 0.12
151 0.11
152 0.08
153 0.07
154 0.06
155 0.07
156 0.07
157 0.06
158 0.08
159 0.09
160 0.1
161 0.12
162 0.13
163 0.13
164 0.16
165 0.2
166 0.25
167 0.26
168 0.26
169 0.25
170 0.26
171 0.26
172 0.24
173 0.2
174 0.14
175 0.16
176 0.16
177 0.17
178 0.16
179 0.16
180 0.15
181 0.16
182 0.14
183 0.11
184 0.12
185 0.1
186 0.09
187 0.11
188 0.12
189 0.1
190 0.1
191 0.12
192 0.1
193 0.11
194 0.12
195 0.1
196 0.08
197 0.09
198 0.09
199 0.08
200 0.07
201 0.06
202 0.05
203 0.05
204 0.04
205 0.03
206 0.03
207 0.02
208 0.02
209 0.02
210 0.02
211 0.02
212 0.02
213 0.02
214 0.02
215 0.02
216 0.02
217 0.03
218 0.03
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.03
228 0.03
229 0.03
230 0.04
231 0.04
232 0.05
233 0.06
234 0.07
235 0.07
236 0.07
237 0.07
238 0.07
239 0.07
240 0.07
241 0.06
242 0.05
243 0.06
244 0.06
245 0.05
246 0.05
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.05
256 0.05
257 0.1
258 0.12
259 0.13
260 0.16
261 0.17
262 0.2
263 0.24
264 0.31
265 0.35
266 0.39
267 0.42
268 0.44
269 0.48
270 0.52
271 0.57
272 0.61
273 0.61
274 0.63
275 0.7
276 0.73
277 0.78
278 0.81
279 0.81
280 0.79
281 0.78
282 0.81
283 0.78
284 0.72
285 0.64
286 0.53
287 0.45
288 0.37
289 0.3
290 0.26
291 0.2
292 0.19
293 0.19
294 0.19
295 0.2
296 0.19
297 0.18
298 0.14
299 0.16
300 0.17
301 0.17
302 0.24
303 0.29
304 0.36
305 0.44
306 0.45
307 0.46
308 0.51
309 0.57
310 0.56
311 0.57
312 0.59
313 0.58
314 0.57
315 0.55
316 0.52
317 0.45
318 0.39
319 0.32
320 0.23
321 0.16
322 0.14
323 0.11
324 0.08
325 0.09
326 0.09
327 0.1
328 0.1
329 0.09
330 0.09
331 0.1
332 0.1
333 0.09
334 0.1
335 0.1
336 0.14
337 0.14
338 0.15
339 0.15
340 0.14
341 0.14
342 0.13
343 0.12
344 0.09
345 0.1
346 0.08
347 0.08
348 0.09
349 0.09
350 0.08
351 0.08
352 0.1
353 0.11
354 0.13
355 0.13
356 0.13
357 0.13
358 0.14
359 0.14
360 0.13
361 0.13
362 0.13
363 0.15
364 0.16
365 0.16
366 0.18
367 0.18
368 0.18
369 0.18
370 0.18
371 0.2
372 0.18
373 0.21
374 0.24
375 0.29
376 0.31
377 0.31
378 0.31
379 0.3
380 0.31
381 0.33