Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6PUZ0

Protein Details
Accession W6PUZ0    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-30EAAEIKKRRQFRKFSYRGIDLHydrophilic
NLS Segment(s)
PositionSequence
48-78RARRRFNRGLKRKPMGLIKKLRKAKQEAKPN
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR020934  Ribosomal_S15/S19_CS  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
IPR005713  Ribosomal_S19A/S15e  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
PROSITE View protein in PROSITE  
PS00323  RIBOSOMAL_S19  
Amino Acid Sequences MADIEYNAEEAAEIKKRRQFRKFSYRGIDLDQLLDLSSEQLRDVVHARARRRFNRGLKRKPMGLIKKLRKAKQEAKPNEKPDLVKTHLRDMIVVPEMIGSVVGIYSGKEFNQVEIKPEMVGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.4
4 0.5
5 0.58
6 0.63
7 0.66
8 0.76
9 0.78
10 0.81
11 0.8
12 0.76
13 0.69
14 0.64
15 0.57
16 0.46
17 0.39
18 0.3
19 0.22
20 0.17
21 0.15
22 0.1
23 0.08
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.09
30 0.11
31 0.14
32 0.18
33 0.23
34 0.28
35 0.34
36 0.43
37 0.47
38 0.52
39 0.57
40 0.62
41 0.68
42 0.75
43 0.77
44 0.78
45 0.77
46 0.72
47 0.68
48 0.67
49 0.63
50 0.61
51 0.61
52 0.6
53 0.64
54 0.69
55 0.69
56 0.65
57 0.66
58 0.66
59 0.65
60 0.67
61 0.67
62 0.69
63 0.72
64 0.7
65 0.66
66 0.58
67 0.51
68 0.44
69 0.41
70 0.36
71 0.34
72 0.32
73 0.34
74 0.34
75 0.33
76 0.3
77 0.24
78 0.23
79 0.19
80 0.17
81 0.11
82 0.09
83 0.09
84 0.08
85 0.07
86 0.04
87 0.02
88 0.02
89 0.03
90 0.03
91 0.03
92 0.04
93 0.05
94 0.05
95 0.1
96 0.1
97 0.12
98 0.19
99 0.19
100 0.21
101 0.22
102 0.23
103 0.19
104 0.19
105 0.18
106 0.13
107 0.13
108 0.1
109 0.09
110 0.09
111 0.08
112 0.09
113 0.08
114 0.08
115 0.11
116 0.12
117 0.13
118 0.14
119 0.2
120 0.27
121 0.32
122 0.38
123 0.42
124 0.46
125 0.52
126 0.53
127 0.52
128 0.49
129 0.48
130 0.44
131 0.41
132 0.37
133 0.3