Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6R9C1

Protein Details
Accession W6R9C1    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-38NKELRDENEKKKQKRTRSRRQIPAEEGLBasic
NLS Segment(s)
PositionSequence
20-30KKKQKRTRSRR
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MYSAILLAKENKELRDENEKKKQKRTRSRRQIPAEEGLSVQEASQLITEVVEASEAPLYLPRGSPQLGLEPRPRAAARCSGCGRTGHKINRCPER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.45
4 0.48
5 0.56
6 0.65
7 0.66
8 0.75
9 0.79
10 0.79
11 0.83
12 0.84
13 0.85
14 0.87
15 0.91
16 0.91
17 0.91
18 0.88
19 0.81
20 0.76
21 0.66
22 0.55
23 0.44
24 0.34
25 0.26
26 0.18
27 0.13
28 0.08
29 0.07
30 0.07
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.04
42 0.04
43 0.04
44 0.05
45 0.07
46 0.07
47 0.08
48 0.08
49 0.11
50 0.11
51 0.12
52 0.12
53 0.19
54 0.21
55 0.25
56 0.29
57 0.3
58 0.3
59 0.34
60 0.33
61 0.28
62 0.29
63 0.34
64 0.32
65 0.36
66 0.4
67 0.38
68 0.4
69 0.43
70 0.44
71 0.44
72 0.5
73 0.52
74 0.56
75 0.61