Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6QLM0

Protein Details
Accession W6QLM0    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-56QYDAERKKRLRPDGPTQYVDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, nucl 7.5, cyto_nucl 7, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR020946  Flavin_mOase-like  
Gene Ontology GO:0016020  C:membrane  
GO:0050660  F:flavin adenine dinucleotide binding  
GO:0004499  F:N,N-dimethylaniline monooxygenase activity  
GO:0050661  F:NADP binding  
Pfam View protein in Pfam  
PF00743  FMO-like  
Amino Acid Sequences MSEKSVVGLAPPVPDQPTTNIASIAETSDDLQNIQDQYDAERKKRLRPDGPTQYVDLTDDPAYLNEFIVVNTDMLQQRQTRVLIVGAGFGGLLFAVRLLQSGFLRASEILFVDAAGGFGGTWWWNKYPGLVCDVESYTYMPLLEETKYMPPHKYVSGSELRRHAKRIASQWKLSQRALFQTEVDNLVWNERDSQWTVNIKPRGQRSTAIQSDFVILATGLLSSPKIPKLDGLETFEGKVFHTSRWDYDYTGGSPDSPMMDGLRDKTVGFVGTGASAVQVIPHLAGWAKKLIVFQRTPSSVDSRYNHLTDRTWWAKLIKGGPGWQRKRMENFNAFCSNESPLPDVDLVDDGWTKMQSLGVLIGSPSGLDPDYLTRMHQLDLQRQEAIRHRVETTVADPATASALKPWYPGWCKRPCFSDNFLPAFNRPDVSLVDTNGKGIRTVTEKGILVEGQEYDLDTIIFGTGYSLGGSADRGAMTVTGRDNQILPEKWQKGMTSLHGVMTNGFPNLFFPGPYQAGASANQVYVLDQLAVHVAYIISEAGKLISERNPDVTVPGLTIEPDCRSEEEWTSKVLMRARALRGVMDCTPGYFNREGLQFDDGEALRAAQFSIWGEGIKSYVKEIEDWRQTGGLAGLDIQARHGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.25
5 0.26
6 0.26
7 0.25
8 0.23
9 0.23
10 0.21
11 0.19
12 0.15
13 0.12
14 0.13
15 0.14
16 0.14
17 0.13
18 0.13
19 0.16
20 0.16
21 0.15
22 0.15
23 0.13
24 0.18
25 0.27
26 0.31
27 0.31
28 0.39
29 0.43
30 0.5
31 0.59
32 0.65
33 0.65
34 0.69
35 0.76
36 0.78
37 0.82
38 0.75
39 0.68
40 0.6
41 0.51
42 0.44
43 0.34
44 0.26
45 0.19
46 0.17
47 0.15
48 0.13
49 0.15
50 0.13
51 0.13
52 0.11
53 0.11
54 0.1
55 0.12
56 0.13
57 0.1
58 0.11
59 0.16
60 0.16
61 0.17
62 0.21
63 0.21
64 0.23
65 0.27
66 0.27
67 0.23
68 0.22
69 0.22
70 0.2
71 0.18
72 0.17
73 0.12
74 0.11
75 0.09
76 0.08
77 0.07
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.05
86 0.08
87 0.08
88 0.11
89 0.12
90 0.11
91 0.13
92 0.13
93 0.13
94 0.11
95 0.11
96 0.09
97 0.09
98 0.08
99 0.07
100 0.07
101 0.07
102 0.05
103 0.05
104 0.04
105 0.04
106 0.05
107 0.05
108 0.07
109 0.09
110 0.11
111 0.13
112 0.14
113 0.18
114 0.22
115 0.23
116 0.26
117 0.24
118 0.24
119 0.26
120 0.27
121 0.23
122 0.19
123 0.18
124 0.14
125 0.13
126 0.12
127 0.08
128 0.09
129 0.09
130 0.09
131 0.09
132 0.11
133 0.16
134 0.21
135 0.23
136 0.24
137 0.25
138 0.28
139 0.29
140 0.31
141 0.27
142 0.29
143 0.36
144 0.38
145 0.4
146 0.45
147 0.49
148 0.48
149 0.5
150 0.48
151 0.45
152 0.47
153 0.53
154 0.55
155 0.55
156 0.57
157 0.6
158 0.64
159 0.64
160 0.59
161 0.52
162 0.44
163 0.43
164 0.43
165 0.36
166 0.28
167 0.26
168 0.26
169 0.25
170 0.22
171 0.18
172 0.15
173 0.16
174 0.16
175 0.13
176 0.14
177 0.13
178 0.15
179 0.15
180 0.17
181 0.21
182 0.25
183 0.27
184 0.33
185 0.37
186 0.37
187 0.41
188 0.46
189 0.45
190 0.43
191 0.42
192 0.41
193 0.45
194 0.47
195 0.43
196 0.37
197 0.33
198 0.32
199 0.29
200 0.23
201 0.13
202 0.08
203 0.06
204 0.06
205 0.05
206 0.04
207 0.04
208 0.04
209 0.05
210 0.08
211 0.1
212 0.11
213 0.11
214 0.13
215 0.18
216 0.22
217 0.23
218 0.26
219 0.26
220 0.26
221 0.27
222 0.26
223 0.21
224 0.17
225 0.19
226 0.15
227 0.13
228 0.17
229 0.18
230 0.19
231 0.22
232 0.23
233 0.2
234 0.21
235 0.22
236 0.18
237 0.19
238 0.17
239 0.13
240 0.12
241 0.11
242 0.1
243 0.08
244 0.07
245 0.06
246 0.07
247 0.08
248 0.09
249 0.1
250 0.1
251 0.1
252 0.1
253 0.1
254 0.09
255 0.09
256 0.07
257 0.06
258 0.06
259 0.06
260 0.05
261 0.04
262 0.04
263 0.04
264 0.03
265 0.03
266 0.03
267 0.03
268 0.03
269 0.04
270 0.04
271 0.05
272 0.06
273 0.08
274 0.08
275 0.09
276 0.11
277 0.14
278 0.18
279 0.19
280 0.2
281 0.24
282 0.25
283 0.25
284 0.25
285 0.26
286 0.23
287 0.28
288 0.27
289 0.27
290 0.29
291 0.28
292 0.27
293 0.25
294 0.24
295 0.2
296 0.26
297 0.24
298 0.21
299 0.22
300 0.21
301 0.22
302 0.24
303 0.24
304 0.2
305 0.18
306 0.22
307 0.28
308 0.38
309 0.38
310 0.42
311 0.44
312 0.44
313 0.49
314 0.5
315 0.5
316 0.48
317 0.47
318 0.45
319 0.45
320 0.42
321 0.37
322 0.32
323 0.27
324 0.2
325 0.19
326 0.15
327 0.11
328 0.12
329 0.12
330 0.1
331 0.09
332 0.08
333 0.07
334 0.07
335 0.07
336 0.05
337 0.06
338 0.06
339 0.06
340 0.05
341 0.06
342 0.05
343 0.05
344 0.06
345 0.05
346 0.05
347 0.05
348 0.05
349 0.04
350 0.04
351 0.04
352 0.04
353 0.04
354 0.04
355 0.04
356 0.06
357 0.08
358 0.08
359 0.09
360 0.11
361 0.12
362 0.12
363 0.16
364 0.17
365 0.22
366 0.26
367 0.27
368 0.26
369 0.26
370 0.29
371 0.31
372 0.34
373 0.29
374 0.27
375 0.26
376 0.25
377 0.26
378 0.24
379 0.19
380 0.19
381 0.17
382 0.15
383 0.14
384 0.13
385 0.14
386 0.13
387 0.11
388 0.07
389 0.09
390 0.09
391 0.1
392 0.11
393 0.16
394 0.21
395 0.28
396 0.35
397 0.42
398 0.45
399 0.47
400 0.52
401 0.49
402 0.49
403 0.48
404 0.49
405 0.47
406 0.46
407 0.45
408 0.4
409 0.38
410 0.36
411 0.31
412 0.22
413 0.16
414 0.15
415 0.14
416 0.18
417 0.19
418 0.16
419 0.2
420 0.19
421 0.2
422 0.2
423 0.19
424 0.14
425 0.13
426 0.14
427 0.14
428 0.16
429 0.16
430 0.18
431 0.19
432 0.19
433 0.2
434 0.17
435 0.14
436 0.13
437 0.11
438 0.08
439 0.08
440 0.08
441 0.07
442 0.07
443 0.06
444 0.05
445 0.05
446 0.04
447 0.04
448 0.04
449 0.04
450 0.04
451 0.04
452 0.05
453 0.05
454 0.05
455 0.05
456 0.05
457 0.05
458 0.06
459 0.05
460 0.05
461 0.05
462 0.06
463 0.06
464 0.09
465 0.1
466 0.11
467 0.12
468 0.13
469 0.13
470 0.15
471 0.22
472 0.21
473 0.24
474 0.32
475 0.33
476 0.34
477 0.36
478 0.34
479 0.31
480 0.33
481 0.32
482 0.29
483 0.28
484 0.28
485 0.27
486 0.27
487 0.24
488 0.22
489 0.2
490 0.13
491 0.12
492 0.1
493 0.1
494 0.14
495 0.13
496 0.11
497 0.11
498 0.16
499 0.17
500 0.18
501 0.18
502 0.15
503 0.16
504 0.17
505 0.18
506 0.15
507 0.13
508 0.14
509 0.13
510 0.12
511 0.11
512 0.11
513 0.08
514 0.06
515 0.07
516 0.07
517 0.07
518 0.07
519 0.06
520 0.05
521 0.05
522 0.06
523 0.06
524 0.05
525 0.05
526 0.05
527 0.05
528 0.06
529 0.06
530 0.09
531 0.13
532 0.18
533 0.19
534 0.22
535 0.24
536 0.23
537 0.24
538 0.23
539 0.19
540 0.15
541 0.15
542 0.12
543 0.11
544 0.12
545 0.13
546 0.13
547 0.15
548 0.17
549 0.18
550 0.2
551 0.23
552 0.27
553 0.31
554 0.3
555 0.3
556 0.31
557 0.32
558 0.34
559 0.35
560 0.35
561 0.34
562 0.4
563 0.42
564 0.44
565 0.42
566 0.4
567 0.37
568 0.37
569 0.32
570 0.29
571 0.26
572 0.22
573 0.25
574 0.23
575 0.27
576 0.23
577 0.23
578 0.23
579 0.26
580 0.25
581 0.24
582 0.26
583 0.2
584 0.2
585 0.25
586 0.2
587 0.19
588 0.18
589 0.16
590 0.14
591 0.14
592 0.14
593 0.08
594 0.1
595 0.09
596 0.12
597 0.12
598 0.12
599 0.12
600 0.12
601 0.14
602 0.16
603 0.15
604 0.14
605 0.17
606 0.18
607 0.21
608 0.25
609 0.33
610 0.38
611 0.39
612 0.39
613 0.36
614 0.35
615 0.33
616 0.29
617 0.2
618 0.13
619 0.12
620 0.13
621 0.14
622 0.14