Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6PRC9

Protein Details
Accession W6PRC9    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-35PSSIRKRKRSAEHDSSRARKKRBasic
75-100FGSASGKSRRRRGRGRPYPRVKSPLRBasic
NLS Segment(s)
PositionSequence
18-37RKRKRSAEHDSSRARKKRKP
73-98HKFGSASGKSRRRRGRGRPYPRVKSP
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MDTSGSEYEQPLLPSSIRKRKRSAEHDSSRARKKRKPALDDLHKLLVTYHGLQQMQRELNEQLAVCNRQIAKHKFGSASGKSRRRRGRGRPYPRVKSPLRGVLRVEEDMPTFWGRVGEWLRRWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.32
3 0.41
4 0.47
5 0.52
6 0.57
7 0.65
8 0.75
9 0.76
10 0.76
11 0.77
12 0.77
13 0.8
14 0.82
15 0.81
16 0.8
17 0.79
18 0.76
19 0.71
20 0.72
21 0.74
22 0.74
23 0.73
24 0.73
25 0.76
26 0.79
27 0.79
28 0.73
29 0.66
30 0.56
31 0.49
32 0.39
33 0.3
34 0.22
35 0.17
36 0.16
37 0.16
38 0.16
39 0.17
40 0.18
41 0.21
42 0.2
43 0.19
44 0.18
45 0.15
46 0.15
47 0.16
48 0.15
49 0.11
50 0.12
51 0.13
52 0.11
53 0.13
54 0.13
55 0.14
56 0.23
57 0.26
58 0.29
59 0.3
60 0.33
61 0.3
62 0.33
63 0.37
64 0.33
65 0.38
66 0.42
67 0.48
68 0.52
69 0.6
70 0.67
71 0.68
72 0.74
73 0.76
74 0.78
75 0.81
76 0.86
77 0.88
78 0.89
79 0.89
80 0.86
81 0.83
82 0.75
83 0.72
84 0.68
85 0.67
86 0.61
87 0.56
88 0.51
89 0.49
90 0.5
91 0.43
92 0.37
93 0.29
94 0.25
95 0.23
96 0.24
97 0.19
98 0.15
99 0.14
100 0.14
101 0.12
102 0.19
103 0.24
104 0.29