Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6Q9J2

Protein Details
Accession W6Q9J2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-32ADAANQKARRRRKSLFKKASEHydrophilic
NLS Segment(s)
PositionSequence
14-28AANQKARRRRKSLFK
Subcellular Location(s) nucl 17, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MDIQPKLKTKPADAANQKARRRRKSLFKKASEYSSEYDADIYLVLRIKKSGKIFVLVLNIKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.62
3 0.68
4 0.7
5 0.7
6 0.74
7 0.72
8 0.74
9 0.72
10 0.73
11 0.75
12 0.81
13 0.83
14 0.8
15 0.78
16 0.73
17 0.69
18 0.61
19 0.52
20 0.42
21 0.35
22 0.29
23 0.22
24 0.2
25 0.15
26 0.12
27 0.09
28 0.08
29 0.06
30 0.09
31 0.1
32 0.1
33 0.12
34 0.14
35 0.2
36 0.24
37 0.29
38 0.28
39 0.32
40 0.32
41 0.34
42 0.41