Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Q950

Protein Details
Accession W6Q950    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
38-57VEAPQPRRRGRPRGSKNKTABasic
NLS Segment(s)
PositionSequence
43-54PRRRGRPRGSKN
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MVNGPTSFRSTSVKPYHRAPKQDTTEPVSQHDPPPPIVEAPQPRRRGRPRGSKNKTAVITTPGEPFEASDAKEIEDLFNQGVFRFEKYDPTSHGGERIFKSRMVREVKAVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.53
3 0.62
4 0.64
5 0.69
6 0.66
7 0.66
8 0.66
9 0.7
10 0.65
11 0.61
12 0.6
13 0.53
14 0.5
15 0.43
16 0.38
17 0.34
18 0.35
19 0.3
20 0.26
21 0.27
22 0.25
23 0.21
24 0.2
25 0.24
26 0.28
27 0.35
28 0.41
29 0.46
30 0.47
31 0.56
32 0.62
33 0.65
34 0.65
35 0.68
36 0.71
37 0.76
38 0.8
39 0.8
40 0.76
41 0.73
42 0.65
43 0.55
44 0.45
45 0.37
46 0.33
47 0.25
48 0.24
49 0.17
50 0.16
51 0.15
52 0.14
53 0.13
54 0.11
55 0.11
56 0.11
57 0.11
58 0.11
59 0.12
60 0.12
61 0.1
62 0.1
63 0.1
64 0.09
65 0.1
66 0.09
67 0.09
68 0.11
69 0.11
70 0.12
71 0.15
72 0.15
73 0.21
74 0.25
75 0.28
76 0.29
77 0.33
78 0.34
79 0.31
80 0.36
81 0.3
82 0.33
83 0.33
84 0.35
85 0.33
86 0.33
87 0.37
88 0.37
89 0.44
90 0.45
91 0.44