Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6PXJ9

Protein Details
Accession W6PXJ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-107KGRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MFSLRAVFGASSGALRQFFPSVTTRTASLRPFSHMIRNSLTRLRGQAKSGNAVAVANGSAKQVEQVRGMKTRSSVKRLCDGCKPVHRKGRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.13
4 0.13
5 0.13
6 0.15
7 0.18
8 0.18
9 0.2
10 0.21
11 0.2
12 0.22
13 0.26
14 0.26
15 0.27
16 0.25
17 0.27
18 0.28
19 0.29
20 0.34
21 0.33
22 0.34
23 0.33
24 0.34
25 0.33
26 0.34
27 0.34
28 0.27
29 0.29
30 0.3
31 0.28
32 0.28
33 0.3
34 0.27
35 0.29
36 0.27
37 0.23
38 0.18
39 0.16
40 0.13
41 0.09
42 0.07
43 0.04
44 0.05
45 0.04
46 0.04
47 0.04
48 0.07
49 0.09
50 0.1
51 0.14
52 0.17
53 0.2
54 0.24
55 0.26
56 0.25
57 0.26
58 0.34
59 0.35
60 0.4
61 0.41
62 0.4
63 0.48
64 0.5
65 0.51
66 0.5
67 0.49
68 0.5
69 0.56
70 0.59
71 0.6
72 0.65
73 0.67
74 0.63
75 0.64
76 0.68
77 0.63
78 0.61
79 0.62
80 0.6
81 0.63
82 0.66
83 0.66
84 0.66
85 0.71
86 0.77
87 0.78