Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Q6N9

Protein Details
Accession W6Q6N9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-84SLSVIRRLARQRRVPDRFRPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 5, extr 5, cyto 3, pero 2
Family & Domain DBs
Amino Acid Sequences MFLCIVYHFLSELRASPRPAVAYAVVMFALPLWRATLKPLTVPSQLRSPRPTRRLDRFLVSIPLSLSVIRRLARQRRVPDRFRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.23
4 0.25
5 0.25
6 0.25
7 0.23
8 0.18
9 0.17
10 0.15
11 0.14
12 0.12
13 0.1
14 0.09
15 0.07
16 0.07
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.09
23 0.12
24 0.12
25 0.13
26 0.16
27 0.18
28 0.22
29 0.23
30 0.22
31 0.27
32 0.3
33 0.31
34 0.34
35 0.38
36 0.43
37 0.48
38 0.55
39 0.55
40 0.61
41 0.64
42 0.62
43 0.6
44 0.53
45 0.49
46 0.46
47 0.39
48 0.31
49 0.25
50 0.22
51 0.18
52 0.16
53 0.15
54 0.13
55 0.16
56 0.16
57 0.21
58 0.29
59 0.38
60 0.48
61 0.56
62 0.63
63 0.7
64 0.78