Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6QN94

Protein Details
Accession W6QN94    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
105-127RDENENKKQKRARSRRQIPAEEGBasic
NLS Segment(s)
PositionSequence
111-119KKQKRARSR
Subcellular Location(s) mito 21, extr 3, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MAGCFLAAGLIPFLPNRVLLKLNIYLRTPTPPLSRGSDSSRNFTPKTPFNSKDLRRQALSIKALLRTQSRSLISPSKRALNQLIKGCELAMHSAILLAKENKDLRDENENKKQKRARSRRQIPAEEGLSVQEASEIIARLVEALEIPLHPPGGSTQSGLEPRPRAAPRCSGCGKTGHKINRCPDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.12
4 0.14
5 0.16
6 0.16
7 0.21
8 0.27
9 0.31
10 0.32
11 0.31
12 0.31
13 0.31
14 0.35
15 0.32
16 0.3
17 0.3
18 0.3
19 0.32
20 0.35
21 0.37
22 0.36
23 0.41
24 0.46
25 0.44
26 0.46
27 0.48
28 0.47
29 0.44
30 0.45
31 0.43
32 0.41
33 0.47
34 0.51
35 0.48
36 0.48
37 0.56
38 0.56
39 0.6
40 0.62
41 0.58
42 0.51
43 0.5
44 0.5
45 0.48
46 0.46
47 0.38
48 0.32
49 0.3
50 0.29
51 0.3
52 0.28
53 0.23
54 0.23
55 0.25
56 0.24
57 0.23
58 0.26
59 0.32
60 0.31
61 0.34
62 0.34
63 0.34
64 0.33
65 0.34
66 0.37
67 0.35
68 0.39
69 0.38
70 0.38
71 0.33
72 0.32
73 0.3
74 0.24
75 0.17
76 0.13
77 0.08
78 0.06
79 0.06
80 0.06
81 0.07
82 0.06
83 0.07
84 0.07
85 0.07
86 0.11
87 0.12
88 0.12
89 0.15
90 0.15
91 0.16
92 0.26
93 0.32
94 0.35
95 0.45
96 0.52
97 0.51
98 0.59
99 0.61
100 0.59
101 0.64
102 0.68
103 0.69
104 0.72
105 0.81
106 0.82
107 0.86
108 0.83
109 0.76
110 0.71
111 0.61
112 0.5
113 0.4
114 0.31
115 0.23
116 0.18
117 0.13
118 0.08
119 0.06
120 0.06
121 0.07
122 0.07
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.04
130 0.04
131 0.05
132 0.05
133 0.06
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.12
140 0.13
141 0.13
142 0.13
143 0.18
144 0.22
145 0.23
146 0.27
147 0.25
148 0.27
149 0.34
150 0.38
151 0.37
152 0.39
153 0.47
154 0.45
155 0.51
156 0.54
157 0.49
158 0.47
159 0.51
160 0.52
161 0.51
162 0.57
163 0.58
164 0.61
165 0.66