Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6QTE6

Protein Details
Accession W6QTE6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-74ASENGRPPRARRSRRSRRSTTLFCFLHydrophilic
NLS Segment(s)
PositionSequence
53-66GRPPRARRSRRSRR
Subcellular Location(s) mito 13, nucl 5, plas 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MARLVLFPPCWIWLRTRILDCACWSSARDATARPRDGGSFWMRRPISLASENGRPPRARRSRRSRRSTTLFCFLIAHTPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.37
4 0.39
5 0.38
6 0.4
7 0.38
8 0.35
9 0.29
10 0.25
11 0.23
12 0.22
13 0.21
14 0.2
15 0.19
16 0.17
17 0.25
18 0.32
19 0.32
20 0.3
21 0.29
22 0.28
23 0.27
24 0.29
25 0.26
26 0.23
27 0.22
28 0.29
29 0.28
30 0.27
31 0.29
32 0.26
33 0.25
34 0.23
35 0.25
36 0.2
37 0.25
38 0.29
39 0.29
40 0.31
41 0.28
42 0.29
43 0.37
44 0.45
45 0.49
46 0.57
47 0.65
48 0.73
49 0.83
50 0.9
51 0.88
52 0.87
53 0.87
54 0.86
55 0.81
56 0.78
57 0.68
58 0.59
59 0.52
60 0.42
61 0.41