Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6QPQ0

Protein Details
Accession W6QPQ0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
300-320VSEKQSKRLKRQDAIEKERREBasic
NLS Segment(s)
PositionSequence
305-329SKRLKRQDAIEKERRERLQARREKK
Subcellular Location(s) mito 21, nucl 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021036  Ribosomal_S35_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF12298  Bot1p  
Amino Acid Sequences MPPRMQSRSVSNTLLPYLTATSSSSLSSIPSLSSSSSQCLSRQFSATAAPQAQTKLRRQMFEWLNTEGAVFKHHVPGETNYLTRLKQRGPETSSDASRPFPNNSSFISEPILSEELRNEVYHRVVEQKMSLRAVSVHLGIDMKRIAAVVRLVELEKRQRAQGKPLALPYARAIHEMVPTTPLAQQGERQEYHEPINDLPAHPLTGSQIFYPVPESRSFTRVEAGRVFSGAPAMEHSEAAEISHPSDLAEKIIEDPNSIAWVGKGANARQILQPADVRIPHPHMVALERDRLAHPNERLAVSEKQSKRLKRQDAIEKERRERLQARREKKLTVVSPEDSRFDYRIKDTIYTPETTGADGRGSKAVGRRYGVPHRDRTRGEIKIPTRVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.29
3 0.23
4 0.2
5 0.17
6 0.16
7 0.14
8 0.14
9 0.14
10 0.15
11 0.14
12 0.12
13 0.12
14 0.13
15 0.12
16 0.11
17 0.11
18 0.12
19 0.13
20 0.16
21 0.17
22 0.19
23 0.21
24 0.22
25 0.23
26 0.28
27 0.32
28 0.32
29 0.33
30 0.31
31 0.29
32 0.32
33 0.33
34 0.32
35 0.28
36 0.26
37 0.25
38 0.27
39 0.32
40 0.34
41 0.38
42 0.42
43 0.45
44 0.46
45 0.46
46 0.54
47 0.55
48 0.56
49 0.53
50 0.45
51 0.41
52 0.39
53 0.37
54 0.28
55 0.21
56 0.16
57 0.14
58 0.13
59 0.18
60 0.19
61 0.21
62 0.22
63 0.26
64 0.31
65 0.31
66 0.3
67 0.27
68 0.29
69 0.29
70 0.31
71 0.32
72 0.28
73 0.33
74 0.37
75 0.42
76 0.44
77 0.47
78 0.48
79 0.48
80 0.47
81 0.43
82 0.39
83 0.34
84 0.35
85 0.33
86 0.3
87 0.29
88 0.3
89 0.3
90 0.3
91 0.34
92 0.3
93 0.28
94 0.27
95 0.23
96 0.2
97 0.21
98 0.2
99 0.14
100 0.13
101 0.13
102 0.12
103 0.13
104 0.13
105 0.12
106 0.12
107 0.13
108 0.14
109 0.14
110 0.17
111 0.17
112 0.18
113 0.2
114 0.23
115 0.24
116 0.25
117 0.24
118 0.19
119 0.19
120 0.2
121 0.18
122 0.13
123 0.1
124 0.1
125 0.11
126 0.1
127 0.11
128 0.1
129 0.08
130 0.08
131 0.08
132 0.07
133 0.08
134 0.08
135 0.07
136 0.07
137 0.08
138 0.08
139 0.1
140 0.13
141 0.17
142 0.19
143 0.2
144 0.23
145 0.29
146 0.3
147 0.37
148 0.39
149 0.39
150 0.38
151 0.38
152 0.39
153 0.32
154 0.32
155 0.26
156 0.25
157 0.21
158 0.19
159 0.18
160 0.15
161 0.17
162 0.17
163 0.15
164 0.12
165 0.11
166 0.11
167 0.12
168 0.12
169 0.11
170 0.1
171 0.14
172 0.16
173 0.21
174 0.21
175 0.22
176 0.22
177 0.22
178 0.24
179 0.23
180 0.2
181 0.15
182 0.18
183 0.17
184 0.15
185 0.15
186 0.13
187 0.11
188 0.1
189 0.1
190 0.08
191 0.09
192 0.09
193 0.08
194 0.09
195 0.09
196 0.09
197 0.12
198 0.12
199 0.12
200 0.13
201 0.16
202 0.16
203 0.18
204 0.2
205 0.17
206 0.2
207 0.2
208 0.22
209 0.21
210 0.21
211 0.19
212 0.18
213 0.18
214 0.13
215 0.13
216 0.1
217 0.07
218 0.06
219 0.08
220 0.08
221 0.08
222 0.08
223 0.08
224 0.08
225 0.08
226 0.08
227 0.06
228 0.07
229 0.07
230 0.07
231 0.07
232 0.09
233 0.09
234 0.08
235 0.08
236 0.07
237 0.1
238 0.13
239 0.13
240 0.12
241 0.12
242 0.11
243 0.12
244 0.12
245 0.09
246 0.06
247 0.07
248 0.07
249 0.1
250 0.13
251 0.12
252 0.18
253 0.19
254 0.21
255 0.21
256 0.23
257 0.21
258 0.2
259 0.21
260 0.18
261 0.2
262 0.2
263 0.2
264 0.21
265 0.24
266 0.24
267 0.23
268 0.21
269 0.19
270 0.2
271 0.24
272 0.24
273 0.24
274 0.22
275 0.24
276 0.24
277 0.26
278 0.28
279 0.3
280 0.28
281 0.29
282 0.31
283 0.3
284 0.31
285 0.32
286 0.33
287 0.3
288 0.38
289 0.35
290 0.41
291 0.48
292 0.53
293 0.59
294 0.65
295 0.69
296 0.66
297 0.74
298 0.76
299 0.79
300 0.82
301 0.81
302 0.79
303 0.76
304 0.77
305 0.7
306 0.67
307 0.64
308 0.65
309 0.66
310 0.68
311 0.7
312 0.72
313 0.74
314 0.69
315 0.66
316 0.65
317 0.6
318 0.58
319 0.56
320 0.49
321 0.52
322 0.51
323 0.48
324 0.42
325 0.39
326 0.34
327 0.3
328 0.31
329 0.28
330 0.31
331 0.32
332 0.32
333 0.3
334 0.37
335 0.38
336 0.36
337 0.33
338 0.32
339 0.3
340 0.29
341 0.28
342 0.21
343 0.21
344 0.19
345 0.2
346 0.18
347 0.18
348 0.2
349 0.25
350 0.31
351 0.33
352 0.35
353 0.39
354 0.44
355 0.54
356 0.6
357 0.62
358 0.66
359 0.67
360 0.73
361 0.69
362 0.69
363 0.68
364 0.64
365 0.63
366 0.62
367 0.59
368 0.61